tasslihorec sfaxoistadet bintestcss PK;N\ӄ0 xhtml10t.vimnu[let g:xmldata_xhtml10t = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'accesskey': [], 'rel': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'target': [], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'charset': [], 'xml:lang': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script', 'p'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'applet': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'width': [], 'object': [], 'id': [], 'code': [], 'vspace': [], 'archive': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'style': [], 'name': [], 'height': [], 'hspace': [], 'title': [], 'class': [], 'codebase': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'nohref': ['BOOL'], 'target': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'alt': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'b': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'target': [], 'href': [], 'id': []} \ ], \ 'basefont': [ \ [], \ { 'size': [], 'face': [], 'color': [], 'id': []} \ ], \ 'bdo': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'big': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'vlink': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'alink': [], 'onkeyup': [], 'bgcolor': [], 'text': [], 'onmouseup': [], 'id': [], 'link': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'background': [], 'xml:lang': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'table', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'noscript', 'ins', 'del', 'script'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'value': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'center': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dir': [ \ ['li'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'font': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'dir': ['ltr', 'rtl'], 'size': [], 'face': [], 'color': [], 'id': [], 'lang': [], 'style': [], 'xml:lang': [], 'title': [], 'class': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'target': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['get', 'post'], 'onmouseover': [], 'lang': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h2': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h3': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h4': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h5': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h6': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'head': [ \ ['script', 'style', 'meta', 'link', 'object', 'isindex', 'title', 'script', 'style', 'meta', 'link', 'object', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object', 'isindex', 'title', 'script', 'style', 'meta', 'link', 'object', 'isindex'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'hr': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'noshade': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'i': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'iframe': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'width': [], 'scrolling': ['auto', 'yes', 'no', 'auto'], 'marginwidth': [], 'id': [], 'marginheight': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'height': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'vspace': [], 'onmouseover': [], 'alt': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'height': [], 'border': [], 'hspace': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['text', 'password', 'checkbox', 'radio', 'submit', 'reset', 'file', 'hidden', 'image', 'button'], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'size': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'tabindex': [], 'alt': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'isindex': [ \ [], \ { 'id': [], 'lang': [], 'prompt': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'xml:lang': []} \ ], \ 'kbd': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'label': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'legend': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'target': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'noscript', 'ins', 'del', 'script', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'onclick': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmouseout': [], 'onmousemove': [], 'xml:lang': []} \ ], \ 'menu': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'id': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'noframes': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'vspace': [], 'tabindex': [], 'standby': [], 'archive': [], 'classid': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'height': [], 'xml:lang': [], 'border': [], 'codetype': [], 'hspace': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'start': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['data', 'ref', 'object']} \ ], \ 'pre': [ \ ['a', 'br', 'span', 'bdo', 'tt', 'i', 'b', 'u', 's', 'strike', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'xml:space': ['preserve'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'q': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 's': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'samp': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'script': [ \ [''], \ { 'id': [], 'src': [], 'charset': [], 'xml:space': ['preserve'], 'type': ['text/javascript'], 'defer': ['BOOL'], 'language': []} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'span': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'strike': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'strong': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'style': [ \ [''], \ { 'media': [], 'id': [], 'lang': [], 'xml:space': ['preserve'], 'title': [], 'type': ['text/css'], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'sub': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'sup': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody', 'tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'bgcolor': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'height': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'noframes', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'height': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'id': [], 'lang': [], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'tt': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'u': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': ['disc', 'square', 'circle'], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'var': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\- html40s.vimnu[let g:xmldata_html40s = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'rel': [], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onkeydown': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'name': [], 'style': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'nohref': ['BOOL'], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'shape': ['rect', 'circle', 'poly', 'default'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'href': []} \ ], \ 'bdo': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'script', 'ins', 'del'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'hr', 'table', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'hr', 'table', 'fieldset', 'address', 'script'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['GET', 'POST'], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'head': [ \ ['title', 'base', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'hr': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'alt': [], 'lang': [], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE', 'BUTTON'], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'alt': [], 'tabindex': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'label': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'legend': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl']} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'archive': [], 'standby': [], 'tabindex': [], 'classid': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'codetype': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['DATA', 'REF', 'OBJECT']} \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'br', 'script', 'map', 'q', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'q': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'script': [ \ [], \ { 'src': [], 'for': [], 'charset': [], 'event': [], 'type': [], 'defer': ['BOOL']} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'span': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'style': [ \ [], \ { 'media': [], 'lang': [], 'type': [], 'title': [], 'dir': ['ltr', 'rtl']} \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'datapagesize': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'headers': [], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'headers': [], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'lang': [], 'dir': ['ltr', 'rtl']} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\@BHJ xhtml10f.vimnu[let g:xmldata_xhtml10f = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'accesskey': [], 'rel': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'target': [], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'charset': [], 'xml:lang': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script', 'p'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'applet': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'width': [], 'object': [], 'id': [], 'code': [], 'vspace': [], 'archive': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'style': [], 'name': [], 'height': [], 'hspace': [], 'title': [], 'class': [], 'codebase': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'nohref': ['BOOL'], 'target': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'alt': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'b': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'target': [], 'href': [], 'id': []} \ ], \ 'basefont': [ \ [], \ { 'size': [], 'face': [], 'color': [], 'id': []} \ ], \ 'bdo': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'big': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'vlink': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'alink': [], 'onkeyup': [], 'bgcolor': [], 'text': [], 'onmouseup': [], 'id': [], 'link': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'background': [], 'xml:lang': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'table', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'noscript', 'ins', 'del', 'script'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'value': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'center': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dir': [ \ ['li'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'font': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'dir': ['ltr', 'rtl'], 'size': [], 'face': [], 'color': [], 'id': [], 'lang': [], 'style': [], 'xml:lang': [], 'title': [], 'class': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'target': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['get', 'post'], 'onmouseover': [], 'lang': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'frame': [ \ [], \ { 'scrolling': ['auto', 'yes', 'no', 'auto'], 'noresize': ['BOOL'], 'marginwidth': [], 'id': [], 'marginheight': [], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'frameset': [ \ ['frameset', 'frame', 'noframes'], \ { 'rows': [], 'cols': [], 'id': [], 'style': [], 'onunload': [], 'onload': [], 'class': [], 'title': []} \ ], \ 'h1': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h2': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h3': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h4': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h5': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h6': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'head': [ \ ['script', 'style', 'meta', 'link', 'object', 'isindex', 'title', 'script', 'style', 'meta', 'link', 'object', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object', 'isindex', 'title', 'script', 'style', 'meta', 'link', 'object', 'isindex'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'hr': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'noshade': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'html': [ \ ['head', 'frameset'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'i': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'iframe': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'width': [], 'scrolling': ['auto', 'yes', 'no', 'auto'], 'marginwidth': [], 'id': [], 'marginheight': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'height': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'vspace': [], 'onmouseover': [], 'alt': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'height': [], 'border': [], 'hspace': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['text', 'password', 'checkbox', 'radio', 'submit', 'reset', 'file', 'hidden', 'image', 'button'], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'size': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'tabindex': [], 'alt': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'isindex': [ \ [], \ { 'id': [], 'lang': [], 'prompt': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'xml:lang': []} \ ], \ 'kbd': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'label': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'legend': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'target': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'noscript', 'ins', 'del', 'script', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'onclick': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmouseout': [], 'onmousemove': [], 'xml:lang': []} \ ], \ 'menu': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'id': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'noframes': [ \ ['body'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'vspace': [], 'tabindex': [], 'standby': [], 'archive': [], 'classid': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'height': [], 'xml:lang': [], 'border': [], 'codetype': [], 'hspace': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'start': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['data', 'ref', 'object']} \ ], \ 'pre': [ \ ['a', 'br', 'span', 'bdo', 'tt', 'i', 'b', 'u', 's', 'strike', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'xml:space': ['preserve'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'q': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 's': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'samp': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'script': [ \ [''], \ { 'id': [], 'src': [], 'charset': [], 'xml:space': ['preserve'], 'type': ['text/javascript'], 'defer': ['BOOL'], 'language': []} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'span': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'strike': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'strong': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'style': [ \ [''], \ { 'media': [], 'id': [], 'lang': [], 'xml:space': ['preserve'], 'title': [], 'type': ['text/css'], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'sub': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'sup': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody', 'tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'bgcolor': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'height': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'menu', 'dir', 'pre', 'hr', 'blockquote', 'address', 'center', 'isindex', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'height': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'id': [], 'lang': [], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'tt': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'u': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': ['disc', 'square', 'circle'], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'var': [ \ ['a', 'br', 'span', 'bdo', 'object', 'applet', 'img', 'map', 'iframe', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'font', 'basefont', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'frame': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\BB html401s.vimnu[let g:xmldata_html401s = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'rel': [], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onkeydown': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'name': [], 'style': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'nohref': ['BOOL'], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'shape': ['rect', 'circle', 'poly', 'default'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'href': []} \ ], \ 'bdo': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'script', 'ins', 'del'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'hr', 'table', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'hr', 'table', 'fieldset', 'address', 'script'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['GET', 'POST'], 'onmouseover': [], 'lang': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'head': [ \ ['title', 'base', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'hr': [ \ [], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'alt': [], 'lang': [], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'height': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE', 'BUTTON'], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'ismap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'alt': [], 'tabindex': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'label': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'legend': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl']} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'archive': [], 'standby': [], 'tabindex': [], 'classid': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'codetype': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['DATA', 'REF', 'OBJECT']} \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'br', 'script', 'map', 'q', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'q': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'script': [ \ [], \ { 'src': [], 'for': [], 'charset': [], 'event': [], 'type': [], 'defer': ['BOOL']} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'span': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'style': [ \ [], \ { 'media': [], 'lang': [], 'type': [], 'title': [], 'dir': ['ltr', 'rtl']} \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'datapagesize': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'headers': [], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'pre', 'dl', 'div', 'noscript', 'blockquote', 'form', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'headers': [], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'lang': [], 'dir': ['ltr', 'rtl']} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'object', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\^ xhtml11.vimnu[let g:xmldata_xhtml11 = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'coords': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'onclick': [], 'class': [], 'title': []} \ ], \ 'acronym': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'area': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'nohref': ['BOOL'], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'b': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'href': []} \ ], \ 'bdo': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'id': [], 'style': [], 'xml:lang': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'br': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'ins', 'del', 'script', 'noscript', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'img', 'map', 'object'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'form': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'ins', 'del', 'script', 'noscript', 'fieldset'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'enctype': ['application/x-www-form-urlencoded'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'method': ['get', 'post'], 'onmouseover': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h2': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h3': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h4': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h5': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h6': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'head': [ \ ['script', 'style', 'meta', 'link', 'object', 'title', 'script', 'style', 'meta', 'link', 'object', 'base', 'script', 'style', 'meta', 'link', 'object', 'base', 'script', 'style', 'meta', 'link', 'object', 'title', 'script', 'style', 'meta', 'link', 'object'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'profile': [''], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'hr': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'version': ['-//W3C//DTD XHTML 1.1//EN'], 'xml:lang': []} \ ], \ 'i': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'ismap': ['BOOL']} \ ], \ 'input': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onkeyup': [], 'onmouseup': [], 'id': [], 'maxlength': [], 'onmouseover': [], 'alt': [], 'tabindex': [], 'accept': [], 'value': [], 'src': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['text', 'password', 'checkbox', 'radio', 'submit', 'reset', 'file', 'hidden', 'image', 'button'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'ins': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'kbd': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'label': [ \ ['input', 'select', 'textarea', 'button', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'bdo', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'a', 'img', 'map', 'object', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'accesskey': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'for': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'legend': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'accesskey': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'li': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'link': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'rel': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'charset': [], 'xml:lang': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': []} \ ], \ 'map': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'ins', 'del', 'script', 'noscript', 'area'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'meta': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'http-equiv': [], 'content': [], 'dir': ['ltr', 'rtl'], 'name': [], 'scheme': [], 'xml:lang': []} \ ], \ 'noscript': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'object': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript', 'param'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'archive': [], 'standby': [], 'tabindex': [], 'classid': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'data': [], 'xml:lang': [], 'height': [], 'codetype': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': []} \ ], \ 'option': [ \ [''], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'value': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'param': [ \ [], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'id': [], 'value': [], 'name': [], 'valuetype': ['data', 'ref', 'object'], 'type': []} \ ], \ 'pre': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'bdo', 'a', 'script', 'map'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:space': ['preserve'], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'q': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'rb': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'rbc': [ \ ['rb'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'rp': [ \ [''], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'rt': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'rtc': [ \ ['rt'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'ruby': [ \ ['rb', 'rt', 'rp', 'rt', 'rp', 'rbc', 'rtc'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'samp': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'script': [ \ [''], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'defer': ['BOOL'], 'src': [], 'charset': [], 'xml:space': ['preserve'], 'type': ['text/javascript']} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'span': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'strong': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'style': [ \ [''], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'media': [], 'xml:lang': [], 'xml:space': ['preserve'], 'title': [], 'type': ['text/css']} \ ], \ 'sub': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'sup': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody', 'tr'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'width': [], 'ondblclick': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'summary': [], 'onmouseup': [], 'cellspacing': [], 'id': [], 'onmouseover': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'border': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'td': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'headers': [], 'ondblclick': [], 'axis': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'rowspan': ['1'], 'colspan': ['1'], 'onmouseup': [], 'id': [], 'charoff': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'textarea': [ \ [''], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'rows': [], 'dir': ['ltr', 'rtl'], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'th': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dl', 'p', 'div', 'pre', 'blockquote', 'address', 'hr', 'table', 'form', 'fieldset', 'br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'headers': [], 'ondblclick': [], 'axis': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'rowspan': ['1'], 'colspan': ['1'], 'onmouseup': [], 'id': [], 'charoff': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'thead': [ \ ['tr'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'title': [ \ [''], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'tt': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'ul': [ \ ['li'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'var': [ \ ['br', 'span', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'q', 'tt', 'i', 'b', 'big', 'small', 'sub', 'sup', 'bdo', 'a', 'img', 'map', 'object', 'input', 'select', 'textarea', 'label', 'button', 'ruby', 'ins', 'del', 'script', 'noscript'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\1uxsd.vimnu[" Author: Thomas Barthel " Last change: 2007 May 8 let g:xmldata_xsd = { \ 'schema': [ \ [ 'include', 'import', 'redefine', 'annotation', 'simpleType', 'complexType', 'element', 'attribute', 'attributeGroup', 'group', 'notation', 'annotation'], \ { 'targetNamespace' : [], 'version' : [], 'xmlns' : [], 'finalDefault' : [], 'blockDefault' : [], 'id' : [], 'elementFormDefault' : [], 'attributeFormDefault' : [], 'xml:lang' : [] }], \ 'redefine' : [ \ ['annotation', 'simpleType', 'complexType', 'attributeGroup', 'group'], \ {'schemaLocation' : [], 'id' : []} ], \ 'include' : [ \ ['annotation'], \ {'namespace' : [], 'id' : []} ], \ 'import' : [ \ ['annotation'], \ {'namespace' : [], 'schemaLocation' : [], 'id' : []} ], \ 'complexType' : [ \ ['annotation', 'simpleContent', 'complexContent', 'all', 'choice', 'sequence', 'group', 'attribute', 'attributeGroup', 'anyAttribute'], \ {'name' : [], 'id' : [], 'abstract' : [], 'final' : [], 'block' : [], 'mixed' : []} ], \ 'complexContent' : [ \ ['annotation', 'restriction', 'extension'], \ {'mixed' : [], 'id' : [] } ], \ 'simpleType' : [ \ ['annotation', 'restriction', 'list', 'union'], \ {'name' : [], 'final' : [], 'id' : []} ], \ 'simpleContent' : [ \ ['annotation', 'restriction', 'extension'], \ {'id' : []} ], \ 'element' : [ \ ['annotation', 'complexType', 'simpleType', 'unique', 'key', 'keyref'], \ {'name' : [], 'id' : [], 'ref' : [], 'type' : [], 'minOccurs' : [], 'maxOccurs' : [], 'nillable' : [], 'substitutionGroup' : [], 'abstract' : [], 'final' : [], 'block' : [], 'default' : [], 'fixed' : [], 'form' : []} ], \ 'attribute' : [ \ ['annotation', 'simpleType'], \ {'name' : [], 'id' : [], 'ref' : [], 'type' : [], 'use' : [], 'default' : [], 'fixed' : [], 'form' : []} ], \ 'group' : [ \ ['annotation', 'all', 'choice', 'sequence'], \ {'name' : [], 'ref' : [], 'minOccurs' : [], 'maxOccurs' : [], 'id' : []} ], \ 'choice' : [ \ ['annotation', 'element', 'group', 'choice', 'sequence', 'any'], \ {'minOccurs' : [], 'maxOccurs' : [], 'id' : []} ], \ 'sequence' : [ \ ['annotation', 'element', 'group', 'choice', 'sequence', 'any'], \ {'minOccurs' : [], 'maxOccurs' : [], 'id' : []} ], \ 'all' : [ \ ['annotation', 'element'], \ {'minOccurs' : [], 'maxOccurs' : [], 'id' : []} ], \ 'any' : [ \ ['annotation'], \ {'namespace' : [], 'processContents' : [], 'minOccurs' : [], 'maxOccurs' : [], 'id' : []} ], \ 'unique' : [ \ ['annotation', 'selector', 'field'], \ {'name' : [], 'id' : []} ], \ 'key' : [ \ ['annotation', 'selector', 'field'], \ {'name' : [], 'id' : []} ], \ 'keyref' : [ \ ['annotation', 'selector', 'field'], \ {'name' : [], 'refer' : [], 'id' : []} ], \ 'selector' : [ \ ['annotation'], \ {'xpath' : [], 'id' : []} ], \ 'field' : [ \ ['annotation'], \ {'xpath' : [], 'id' : []} ], \ 'restriction' : [ \ ['annotation', 'simpleType', 'minExclusive', 'maxExclusive', 'minInclusive', 'maxInclusive', 'totalDigits', 'fractionDigits', 'length', 'minLength', 'maxLength', 'enumeration', 'whiteSpace', 'pattern'], \ {'base' : [], 'id' : []} ], \ 'minExclusive' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'maxExclusive' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'minInclusive' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'maxInclusive' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'totalDigits' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'fractionDigits' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'length' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'minLength' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'maxLength' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'enumeration' : [ \ ['annotation'], \ {'value' : [], 'id' : []}], \ 'whiteSpace' : [ \ ['annotation'], \ {'value' : [], 'id' : [], 'fixed' : []}], \ 'pattern' : [ \ ['annotation'], \ {'value' : [], 'id' : []}], \ 'extension' : [ \ ['annotation', 'all', 'choice', 'sequence', 'group', 'attribute', 'attributeGroup', 'anyAttribute'], \ {'base' : [], 'id' : []} ], \ 'attributeGroup' : [ \ ['annotation', 'attribute', 'attributeGroup', 'anyAttribute'], \ {'name' : [], 'id' : [], 'ref' : []} ], \ 'anyAttribute' : [ \ ['annotation'], \ {'namespace' : [], 'processContents' : [], 'id' : []} ], \ 'list' : [ \ ['annotation', 'simpleType'], \ {'itemType' : [], 'id' : []} ], \ 'union' : [ \ ['annotation', 'simpleType'], \ {'id' : [], 'memberTypes' : []} ], \ 'notation' : [ \ ['annotation'], \ {'name' : [], 'id' : [], 'public' : [], 'system' : []} ], \ 'annotation' : [ \ ['appinfo', 'documentation'], \ {} ], \ 'appinfo' : [ \ [], \ {'source' : [], 'id' : []} ], \ 'documentation' : [ \ [], \ {'source' : [], 'id' : [], 'xml' : []} ] \ } PK;N\Pjj html401f.vimnu[let g:xmldata_html401t = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'rel': [], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'target': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'p'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'applet': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'object': [], 'id': [], 'code': [], 'vspace': [], 'archive': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'style': [], 'name': [], 'height': [], 'hspace': [], 'title': [], 'class': [], 'codebase': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'target': [], 'nohref': ['BOOL'], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'shape': ['rect', 'circle', 'poly', 'default'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'target': [], 'href': []} \ ], \ 'basefont': [ \ [], \ { 'size': [], 'face': [], 'color': [], 'id': []} \ ], \ 'bdo': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del'], \ { 'vlink': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'alink': [], 'onkeyup': [], 'bgcolor': [], 'text': [], 'onmouseup': [], 'id': [], 'link': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'background': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'hr', 'table', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'center': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dir': [ \ ['li'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'font': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'size': [], 'face': [], 'color': [], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'target': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['GET', 'POST'], 'onmouseover': [], 'lang': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'head': [ \ ['title', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'hr': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'noshade': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'html': [ \ ['head', 'frameset'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'frameset': [ \ ['frameset', 'frame', 'noframes'], \ { 'rows': [], 'cols': [], 'id': [], 'style': [], 'onunload': [], 'onload': [], 'class': [], 'title': []} \ ], \ 'frame': [ \ [], \ { 'scrolling': ['auto', 'yes', 'no', 'auto'], 'noresize': ['BOOL'], 'marginwidth': [], 'id': [], 'marginheight': [], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'iframe': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'scrolling': ['auto', 'yes', 'no', 'auto'], 'marginwidth': [], 'id': [], 'marginheight': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'height': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'vspace': [], 'onmouseover': [], 'alt': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'height': [], 'border': [], 'hspace': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE', 'BUTTON'], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'ismap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'tabindex': [], 'accept': [], 'alt': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'isindex': [ \ [], \ { 'id': [], 'lang': [], 'prompt': [], 'class': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'label': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'legend': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'target': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'menu': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl']} \ ], \ 'noframes': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'vspace': [], 'tabindex': [], 'standby': [], 'archive': [], 'classid': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'height': [], 'border': [], 'codetype': [], 'hspace': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'start': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['DATA', 'REF', 'OBJECT']} \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'br', 'script', 'map', 'q', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'width': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'q': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 's': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'script': [ \ [], \ { 'src': [], 'for': [], 'charset': [], 'event': [], 'type': [], 'defer': ['BOOL'], 'language': []} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'span': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strike': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'style': [ \ [], \ { 'media': [], 'lang': [], 'type': [], 'title': [], 'dir': ['ltr', 'rtl']} \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'datapagesize': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'bgcolor': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'lang': [], 'dir': ['ltr', 'rtl']} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'u': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': ['disc', 'square', 'circle'], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\I(]GGxsl.vimnu[" Author: Mikolaj Machowski, Thomas Bartel " Last change: 2007 May 8 let g:xmldata_xsl = { \ 'apply-imports' : [[], {}], \ 'apply-templates' : [['sort', 'with-param'], {'select' : [], 'mode' : []}], \ 'attribute' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'name' : [], 'namespace' : []}], \ 'attribute-set' : [['attribute'], {'name' : [], 'use-attribute-sets' : []}], \ 'call-template' : [['with-param'], {'name' : []}], \ 'choose' : [['when', 'otherwise'], {}], \ 'comment' : [[], {}], \ 'copy' : [[], {'use-attribute-sets' : []}], \ 'copy-of' : [[], {'select' : []}], \ 'decimal-format' : [[], {'name' : [], 'decimal-separator' : [], 'grouping-separator' : [], 'infinity' : [], 'minus-sign' : [], 'NaN' : [], 'percent' : [], 'per-mille' : [], 'zero-digit' : [], 'digit' : [], 'pattern-separator' : []}], \ 'element' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'name' : [], 'namespace' : [], 'use-attribute-sets' : []}], \ 'fallback' : [[], {}], \ 'for-each' : [['sort'], {'select' : []}], \ 'if' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'test' : []}], \ 'import' : [[], {'href' : []}], \ 'include' : [[], {'href' : []}], \ 'key' : [[], {'name' : [], 'match' : [], 'use' : []}], \ 'message' : [[], {'terminate' : ['yes', 'no']}], \ 'namespace-alias' : [[], {'stylesheet-prefix' : ['#default'], 'result-prefix' : ['#default']}], \ 'number' : [[], {'level' : ['single', 'multiple', 'any'], 'count' : [], 'from' : [], 'value' : [], 'format' : [], 'lang' : [], 'letter-value' : ['alphabetic', 'traditional'], 'grouping-separator' : [], 'grouping-size' : []}], \ 'otherwise' : [[], {}], \ 'output' : [[], {'method' : ['xml', 'html', 'text'], 'version' : [], 'encoding' : [], 'omit-xml-declaration' : ['yes', 'no'], 'standalone' : ['yes', 'no'], 'doctype-public' : [], 'doctype-system' : [], 'cdata-section-elements' : [], 'indent' : ['yes', 'no'], 'media-type' : []}], \ 'param' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'name' : [], 'select' : []}], \ 'preserve-space' : [[], {'elements' : []}], \ 'processing-instructionruction' : [[], {'name' : []}], \ 'sort' : [[], {'select' : [], 'lang' : [], 'data-type' : ['text', 'number'], 'order' : ['ascending', 'descending'], 'case-order' : ['upper-first', 'lower-first']}], \ 'strip-space' : [[], {'elements' : []}], \ 'stylesheet' : [['import', 'attribute-set', 'decimal-format', 'include', 'key', 'namespace-alias', 'output', 'param', 'preserve-space', 'strip-space', 'template'], {'id' : [], 'extension-element-prefixes' : [], 'version' : []}], \ 'template' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'match' : [], 'name' : [], 'priority' : [], 'mode' : []}], \ 'text' : [[], {'disable-output-escaping' : ['yes', 'no']}], \ 'transform' : [['import', 'attribute-set', 'decimal-format', 'include', 'key', 'namespace-alias', 'output', 'param', 'preserve-space', 'strip-space', 'template'], {'id' : [], 'extension-element-prefixes' : [], 'exclude-result-prefixes' : [], 'version' : []}], \ 'value-of' : [[], {'select' : [], 'disable-output-escaping' : ['yes', 'no']}], \ 'variable' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'name' : [], 'select' : []}], \ 'when' : [[], {'test' : []}], \ 'with-param' : [['apply-imports', 'apply-templates', 'attribute', 'call-template', 'choose', 'comment', 'copy', 'copy-of', 'element', 'fallback', 'for-each', 'if', 'message', 'number', 'processing-instruction', 'text', 'value-of', 'variable'], {'name' : [], 'select' : []}]} PK;N\S html401t.vimnu[let g:xmldata_html401t = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'rel': [], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'target': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'p'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'applet': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'object': [], 'id': [], 'code': [], 'vspace': [], 'archive': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'style': [], 'name': [], 'height': [], 'hspace': [], 'title': [], 'class': [], 'codebase': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'target': [], 'nohref': ['BOOL'], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'shape': ['rect', 'circle', 'poly', 'default'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'target': [], 'href': []} \ ], \ 'basefont': [ \ [], \ { 'size': [], 'face': [], 'color': [], 'id': []} \ ], \ 'bdo': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del'], \ { 'vlink': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'alink': [], 'onkeyup': [], 'bgcolor': [], 'text': [], 'onmouseup': [], 'id': [], 'link': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'background': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'hr', 'table', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'center': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dir': [ \ ['li'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'font': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'size': [], 'face': [], 'color': [], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'target': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['GET', 'POST'], 'onmouseover': [], 'lang': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'head': [ \ ['title', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'hr': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'noshade': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'dir': ['ltr', 'rtl'], 'lang': [], 'version': ['-//W3C//DTD HTML 4.01 Transitional//EN']} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'iframe': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'scrolling': ['auto', 'yes', 'no', 'auto'], 'marginwidth': [], 'id': [], 'marginheight': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'height': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'vspace': [], 'onmouseover': [], 'alt': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'height': [], 'border': [], 'hspace': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE', 'BUTTON'], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'ismap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'tabindex': [], 'accept': [], 'alt': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'isindex': [ \ [], \ { 'id': [], 'lang': [], 'prompt': [], 'class': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'label': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'legend': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'target': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'menu': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl']} \ ], \ 'noframes': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'vspace': [], 'tabindex': [], 'standby': [], 'archive': [], 'classid': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'height': [], 'border': [], 'codetype': [], 'hspace': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'start': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['DATA', 'REF', 'OBJECT']} \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'br', 'script', 'map', 'q', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'width': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'q': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 's': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'script': [ \ [], \ { 'src': [], 'for': [], 'charset': [], 'event': [], 'type': [], 'defer': ['BOOL'], 'language': []} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'span': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strike': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'style': [ \ [], \ { 'media': [], 'lang': [], 'type': [], 'title': [], 'dir': ['ltr', 'rtl']} \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'datapagesize': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'bgcolor': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'lang': [], 'dir': ['ltr', 'rtl']} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'u': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': ['disc', 'square', 'circle'], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\>GG html32.vimnu[let g:xmldata_html32 = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Aring', 'Atilde', 'Auml', 'Ccedil', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Euml', 'Iacute', 'Icirc', 'Igrave', 'Iuml', 'Ntilde', 'Oacute', 'Ocirc', 'Ograve', 'Oslash', 'Otilde', 'Ouml', 'THORN', 'Uacute', 'Ucirc', 'Ugrave', 'Uuml', 'Yacute', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'amp', 'aring', 'atilde', 'auml', 'brvbar', 'ccedil', 'cedil', 'cent', 'copy', 'curren', 'deg', 'divide', 'eacute', 'ecirc', 'egrave', 'eth', 'euml', 'frac12', 'frac14', 'frac34', 'gt', 'iacute', 'icirc', 'iexcl', 'igrave', 'iquest', 'iuml', 'laquo', 'lt', 'macr', 'micro', 'middot', 'nbsp', 'not', 'ntilde', 'oacute', 'ocirc', 'ograve', 'ordf', 'ordm', 'oslash', 'otilde', 'ouml', 'para', 'plusmn', 'pound', 'raquo', 'reg', 'sect', 'shy', 'sup1', 'sup2', 'sup3', 'szlig', 'thorn', 'times', 'uacute', 'ucirc', 'ugrave', 'uml', 'uuml', 'yacute', 'yen', 'yuml'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'rel': [], 'href': [], 'name': [], 'rev': [], 'title': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p'], \ { } \ ], \ 'applet': [ \ ['param', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'width': [], 'vspace': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'height': [], 'hspace': [], 'codebase': [], 'code': []} \ ], \ 'area': [ \ [], \ { 'alt': [], 'coords': [], 'nohref': ['BOOL'], 'href': [], 'shape': ['rect', 'circle', 'poly']} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'base': [ \ [], \ { 'href': []} \ ], \ 'basefont': [ \ [], \ { 'size': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'blockquote': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table', 'address'], \ { } \ ], \ 'body': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table', 'address'], \ { 'link': [], 'vlink': [], 'background': [], 'alink': [], 'bgcolor': [], 'text': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['top', 'bottom']} \ ], \ 'center': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table', 'address'], \ { } \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'code': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'dd': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table'], \ { } \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'dir': [ \ ['li'], \ { 'compact': ['BOOL']} \ ], \ 'div': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table', 'address'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'compact': ['BOOL']} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'em': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'font': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'size': [], 'color': []} \ ], \ 'form': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'isindex', 'hr', 'table', 'address'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'action': [], 'method': ['GET', 'POST']} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'head': [ \ ['title', 'isindex', 'base', 'script', 'style', 'meta', 'link'], \ { } \ ], \ 'hr': [ \ [], \ { 'width': [], 'align': ['left', 'right', 'center'], 'size': [], 'noshade': ['BOOL']} \ ], \ 'html': [ \ ['head', 'body', 'plaintext'], \ { 'version': ['-//W3C//DTD HTML 3.2 Final//EN']} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'img': [ \ [], \ { 'width': [], 'vspace': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'usemap': [], 'ismap': ['BOOL'], 'src': [], 'height': [], 'border': [], 'hspace': []} \ ], \ 'input': [ \ [], \ { 'maxlength': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'size': [], 'checked': ['BOOL'], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE']} \ ], \ 'isindex': [ \ [], \ { 'prompt': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'li': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table'], \ { 'value': [], 'type': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'href': [], 'rev': [], 'title': []} \ ], \ 'listing': [ \ [], \ { } \ ], \ 'map': [ \ ['area'], \ { 'name': []} \ ], \ 'menu': [ \ ['li'], \ { 'compact': ['BOOL']} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'name': [], 'content': []} \ ], \ 'ol': [ \ ['li'], \ { 'compact': ['BOOL'], 'type': [], 'start': []} \ ], \ 'option': [ \ [''], \ { 'value': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'align': ['left', 'center', 'right']} \ ], \ 'param': [ \ [], \ { 'value': [], 'name': []} \ ], \ 'plaintext': [ \ [], \ { } \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'u', 'strike', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'applet', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { 'width': ['#implied']} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'script': [ \ [], \ { } \ ], \ 'select': [ \ ['option'], \ { 'name': [], 'size': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'strike': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'style': [ \ [], \ { } \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'table': [ \ ['caption', 'tr'], \ { 'width': [], 'align': ['left', 'center', 'right'], 'border': [], 'cellspacing': [], 'cellpadding': []} \ ], \ 'td': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table', 'address'], \ { 'width': [], 'align': ['left', 'center', 'right'], 'nowrap': ['BOOL'], 'valign': ['top', 'middle', 'bottom'], 'height': [], 'rowspan': ['1'], 'colspan': ['1']} \ ], \ 'textarea': [ \ [''], \ { 'name': [], 'rows': [], 'cols': []} \ ], \ 'th': [ \ ['h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea', 'p', 'ul', 'ol', 'dir', 'menu', 'pre', 'xmp', 'listing', 'dl', 'div', 'center', 'blockquote', 'form', 'isindex', 'hr', 'table', 'address'], \ { 'width': [], 'align': ['left', 'center', 'right'], 'nowrap': ['BOOL'], 'valign': ['top', 'middle', 'bottom'], 'height': [], 'rowspan': ['1'], 'colspan': ['1']} \ ], \ 'title': [ \ [''], \ { } \ ], \ 'tr': [ \ ['th', 'td'], \ { 'align': ['left', 'center', 'right'], 'valign': ['top', 'middle', 'bottom']} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'u': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'ul': [ \ ['li'], \ { 'compact': ['BOOL'], 'type': ['disc', 'square', 'circle']} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'u', 'strike', 'big', 'small', 'sub', 'sup', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'a', 'img', 'applet', 'font', 'basefont', 'br', 'script', 'map', 'input', 'select', 'textarea'], \ { } \ ], \ 'xmp': [ \ [], \ { } \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\U~]] html40t.vimnu[let g:xmldata_html40t = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'rel': [], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'target': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'p'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'applet': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'object': [], 'id': [], 'code': [], 'vspace': [], 'archive': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'style': [], 'name': [], 'height': [], 'hspace': [], 'title': [], 'class': [], 'codebase': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'target': [], 'nohref': ['BOOL'], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'shape': ['rect', 'circle', 'poly', 'default'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'target': [], 'href': []} \ ], \ 'basefont': [ \ [], \ { 'size': [], 'face': [], 'color': [], 'id': []} \ ], \ 'bdo': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del'], \ { 'vlink': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'alink': [], 'onkeyup': [], 'bgcolor': [], 'text': [], 'onmouseup': [], 'id': [], 'link': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'background': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'hr', 'table', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'center': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dir': [ \ ['li'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'font': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'size': [], 'face': [], 'color': [], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'target': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['GET', 'POST'], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'head': [ \ ['title', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'hr': [ \ [], \ { 'width': [], 'ondblclick': [], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'noshade': ['BOOL'], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'dir': ['ltr', 'rtl'], 'lang': [], 'version': ['-//W3C//DTD HTML 4.0 Transitional//EN']} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'iframe': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'scrolling': ['auto', 'yes', 'no', 'auto'], 'marginwidth': [], 'id': [], 'marginheight': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'height': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'vspace': [], 'onmouseover': [], 'alt': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'border': [], 'hspace': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE', 'BUTTON'], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'alt': [], 'tabindex': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'isindex': [ \ [], \ { 'id': [], 'lang': [], 'prompt': [], 'class': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'label': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'legend': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'target': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'menu': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl']} \ ], \ 'noframes': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'vspace': [], 'tabindex': [], 'standby': [], 'archive': [], 'classid': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'height': [], 'border': [], 'codetype': [], 'hspace': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'start': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['DATA', 'REF', 'OBJECT']} \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'br', 'script', 'map', 'q', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'width': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'q': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 's': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'script': [ \ [], \ { 'src': [], 'for': [], 'charset': [], 'event': [], 'type': [], 'defer': ['BOOL'], 'language': []} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'span': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strike': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'style': [ \ [], \ { 'media': [], 'lang': [], 'type': [], 'title': [], 'dir': ['ltr', 'rtl']} \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'datapagesize': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'bgcolor': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'lang': [], 'dir': ['ltr', 'rtl']} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'u': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': ['disc', 'square', 'circle'], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\1S\ xhtml10s.vimnu[let g:xmldata_xhtml10s = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'accesskey': [], 'rel': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onkeydown': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'name': [], 'style': [], 'charset': [], 'xml:lang': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'nohref': ['BOOL'], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'alt': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'b': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'href': [], 'id': []} \ ], \ 'bdo': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'big': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'table', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'noscript', 'ins', 'del', 'script'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'value': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'noscript', 'ins', 'del', 'script'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['get', 'post'], 'onmouseover': [], 'lang': [], 'accept': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h2': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h3': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h4': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h5': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'h6': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'head': [ \ ['script', 'style', 'meta', 'link', 'object', 'title', 'script', 'style', 'meta', 'link', 'object', 'base', 'script', 'style', 'meta', 'link', 'object', 'base', 'script', 'style', 'meta', 'link', 'object', 'title', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'hr': [ \ [], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'html': [ \ ['head', 'body'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'i': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'alt': [], 'lang': [], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'height': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['text', 'password', 'checkbox', 'radio', 'submit', 'reset', 'file', 'hidden', 'image', 'button'], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'size': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'tabindex': [], 'alt': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'kbd': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'label': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'legend': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'noscript', 'ins', 'del', 'script', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'onclick': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmouseout': [], 'onmousemove': [], 'xml:lang': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'id': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'archive': [], 'standby': [], 'tabindex': [], 'classid': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'height': [], 'codetype': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['data', 'ref', 'object']} \ ], \ 'pre': [ \ ['a', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'br', 'span', 'bdo', 'map', 'ins', 'del', 'script', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'xml:space': ['preserve'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'q': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'samp': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'script': [ \ [''], \ { 'id': [], 'src': [], 'charset': [], 'xml:space': ['preserve'], 'type': ['text/javascript'], 'defer': ['BOOL']} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'span': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'strong': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'style': [ \ [''], \ { 'media': [], 'id': [], 'lang': [], 'xml:space': ['preserve'], 'title': [], 'type': ['text/css'], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'sub': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'sup': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody', 'tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'headers': [], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'div', 'ul', 'ol', 'dl', 'pre', 'hr', 'blockquote', 'address', 'fieldset', 'table', 'form', 'a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'noscript', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'headers': [], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'id': [], 'lang': [], 'dir': ['ltr', 'rtl'], 'xml:lang': []} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'xml:lang': [], 'char': []} \ ], \ 'tt': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'var': [ \ ['a', 'br', 'span', 'bdo', 'map', 'object', 'img', 'tt', 'i', 'b', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'q', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'sub', 'sup', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del', 'script'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'xml:lang': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PK;N\# html40f.vimnu[let g:xmldata_html40t = { \ 'vimxmlentities': ['AElig', 'Aacute', 'Acirc', 'Agrave', 'Alpha', 'Aring', 'Atilde', 'Auml', 'Beta', 'Ccedil', 'Chi', 'Dagger', 'Delta', 'ETH', 'Eacute', 'Ecirc', 'Egrave', 'Epsilon', 'Eta', 'Euml', 'Gamma', 'Iacute', 'Icirc', 'Igrave', 'Iota', 'Iuml', 'Kappa', 'Lambda', 'Mu', 'Ntilde', 'Nu', 'OElig', 'Oacute', 'Ocirc', 'Ograve', 'Omega', 'Omicron', 'Oslash', 'Otilde', 'Ouml', 'Phi', 'Pi', 'Prime', 'Psi', 'Rho', 'Scaron', 'Sigma', 'THORN', 'Tau', 'Theta', 'Uacute', 'Ucirc', 'Ugrave', 'Upsilon', 'Uuml', 'Xi', 'Yacute', 'Yuml', 'Zeta', 'aacute', 'acirc', 'acute', 'aelig', 'agrave', 'alefsym', 'alpha', 'amp', 'and', 'ang', 'apos', 'aring', 'asymp', 'atilde', 'auml', 'bdquo', 'beta', 'brvbar', 'bull', 'cap', 'ccedil', 'cedil', 'cent', 'chi', 'circ', 'clubs', 'cong', 'copy', 'crarr', 'cup', 'curren', 'dArr', 'dagger', 'darr', 'deg', 'delta', 'diams', 'divide', 'eacute', 'ecirc', 'egrave', 'empty', 'emsp', 'ensp', 'epsilon', 'equiv', 'eta', 'eth', 'euml', 'euro', 'exist', 'fnof', 'forall', 'frac12', 'frac14', 'frac34', 'frasl', 'gamma', 'ge', 'gt', 'hArr', 'harr', 'hearts', 'hellip', 'iacute', 'icirc', 'iexcl', 'igrave', 'image', 'infin', 'int', 'iota', 'iquest', 'isin', 'iuml', 'kappa', 'lArr', 'lambda', 'lang', 'laquo', 'larr', 'lceil', 'ldquo', 'le', 'lfloor', 'lowast', 'loz', 'lrm', 'lsaquo', 'lsquo', 'lt', 'macr', 'mdash', 'micro', 'middot', 'minus', 'mu', 'nabla', 'nbsp', 'ndash', 'ne', 'ni', 'not', 'notin', 'nsub', 'ntilde', 'nu', 'oacute', 'ocirc', 'oelig', 'ograve', 'oline', 'omega', 'omicron', 'oplus', 'or', 'ordf', 'ordm', 'oslash', 'otilde', 'otimes', 'ouml', 'para', 'part', 'permil', 'perp', 'phi', 'pi', 'piv', 'plusmn', 'pound', 'prime', 'prod', 'prop', 'psi', 'quot', 'rArr', 'radic', 'rang', 'raquo', 'rarr', 'rceil', 'rdquo', 'real', 'reg', 'rfloor', 'rho', 'rlm', 'rsaquo', 'rsquo', 'sbquo', 'scaron', 'sdot', 'sect', 'shy', 'sigma', 'sigmaf', 'sim', 'spades', 'sub', 'sube', 'sum', 'sup', 'sup1', 'sup2', 'sup3', 'supe', 'szlig', 'tau', 'there4', 'theta', 'thetasym', 'thinsp', 'thorn', 'tilde', 'times', 'trade', 'uArr', 'uacute', 'uarr', 'ucirc', 'ugrave', 'uml', 'upsih', 'upsilon', 'uuml', 'weierp', 'xi', 'yacute', 'yen', 'yuml', 'zeta', 'zwj', 'zwnj'], \ 'vimxmlroot': ['html'], \ 'a': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'rel': [], 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'target': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'tabindex': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'name': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'shape': ['rect', 'circle', 'poly', 'default']} \ ], \ 'abbr': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'acronym': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'address': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'p'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'applet': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'object': [], 'id': [], 'code': [], 'vspace': [], 'archive': [], 'alt': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'style': [], 'name': [], 'height': [], 'hspace': [], 'title': [], 'class': [], 'codebase': []} \ ], \ 'area': [ \ [], \ { 'accesskey': [], 'coords': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'target': [], 'nohref': ['BOOL'], 'onfocus': [], 'onkeyup': [], 'href': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'alt': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'shape': ['rect', 'circle', 'poly', 'default'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'b': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'base': [ \ [], \ { 'target': [], 'href': []} \ ], \ 'basefont': [ \ [], \ { 'size': [], 'face': [], 'color': [], 'id': []} \ ], \ 'bdo': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'big': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'blockquote': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'body': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button', 'ins', 'del'], \ { 'vlink': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'alink': [], 'onkeyup': [], 'bgcolor': [], 'text': [], 'onmouseup': [], 'id': [], 'link': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'background': [], 'onunload': [], 'onkeypress': [], 'onmousedown': [], 'onload': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'br': [ \ [], \ { 'clear': ['none', 'left', 'all', 'right', 'none'], 'id': [], 'style': [], 'class': [], 'title': []} \ ], \ 'button': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'hr', 'table', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo'], \ { 'accesskey': [], 'disabled': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onkeydown': [], 'onfocus': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'tabindex': [], 'value': [], 'name': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': ['submit', 'button', 'submit', 'reset']} \ ], \ 'caption': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'center': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'cite': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'code': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'col': [ \ [], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'colgroup': [ \ ['col'], \ { 'width': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'charoff': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'char': [], 'span': ['1'], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dd': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'del': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'cite': [], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dfn': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dir': [ \ ['li'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'div': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'dl': [ \ ['dt', 'dd'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'dt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'em': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'fieldset': [ \ ['legend', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'font': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'dir': ['ltr', 'rtl'], 'size': [], 'face': [], 'color': [], 'id': [], 'lang': [], 'style': [], 'class': [], 'title': []} \ ], \ 'form': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'enctype': ['application/x-www-form-urlencoded'], 'onsubmit': [], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'target': [], 'onkeyup': [], 'onmouseup': [], 'onreset': [], 'id': [], 'method': ['GET', 'POST'], 'onmouseover': [], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'accept-charset': [], 'onkeypress': [], 'onmousedown': [], 'action': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h1': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h2': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h3': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h4': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h5': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'h6': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'head': [ \ ['title', 'isindex', 'base', 'script', 'style', 'meta', 'link', 'object'], \ { 'profile': [], 'dir': ['ltr', 'rtl'], 'lang': []} \ ], \ 'hr': [ \ [], \ { 'width': [], 'ondblclick': [], 'size': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right'], 'style': [], 'onmousemove': [], 'onmouseout': [], 'noshade': ['BOOL'], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'html': [ \ ['head', 'frameset'], \ { 'xmlns': ['http://www.w3.org/1999/xhtml'], 'dir': ['ltr', 'rtl'], 'id': [], 'lang': [], 'xml:lang': []} \ ], \ 'frameset': [ \ ['frameset', 'frame', 'noframes'], \ { 'rows': [], 'cols': [], 'id': [], 'style': [], 'onunload': [], 'onload': [], 'class': [], 'title': []} \ ], \ 'frame': [ \ [], \ { 'scrolling': ['auto', 'yes', 'no', 'auto'], 'noresize': ['BOOL'], 'marginwidth': [], 'id': [], 'marginheight': [], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'i': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': []} \ ], \ 'iframe': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'width': [], 'scrolling': ['auto', 'yes', 'no', 'auto'], 'marginwidth': [], 'id': [], 'marginheight': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'longdesc': [], 'src': [], 'style': [], 'name': [], 'height': [], 'frameborder': ['1', '0'], 'title': [], 'class': []} \ ], \ 'img': [ \ [], \ { 'width': [], 'usemap': [], 'ismap': ['BOOL'], 'ondblclick': [], 'dir': ['ltr', 'rtl'], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'vspace': [], 'onmouseover': [], 'alt': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'src': [], 'longdesc': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'border': [], 'hspace': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': []} \ ], \ 'input': [ \ [], \ { 'ondblclick': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'value': [], 'src': [], 'name': [], 'checked': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'type': ['TEXT', 'PASSWORD', 'CHECKBOX', 'RADIO', 'SUBMIT', 'RESET', 'FILE', 'IMAGE', 'BUTTON'], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'usemap': [], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'maxlength': [], 'onselect': [], 'accept': [], 'alt': [], 'tabindex': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ins': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'datetime': [], 'cite': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'isindex': [ \ [], \ { 'id': [], 'lang': [], 'prompt': [], 'class': [], 'title': [], 'dir': ['ltr', 'rtl'], 'style': []} \ ], \ 'kbd': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'label': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'for': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'legend': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['top', 'bottom', 'left', 'right'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'li': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'link': [ \ [], \ { 'rel': [], 'ondblclick': [], 'onkeydown': [], 'target': [], 'onkeyup': [], 'href': [], 'media': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'charset': [], 'hreflang': [], 'onkeypress': [], 'onmousedown': [], 'rev': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'map': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'area'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'menu': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'meta': [ \ [], \ { 'http-equiv': [], 'content': [], 'lang': [], 'name': [], 'scheme': [], 'dir': ['ltr', 'rtl']} \ ], \ 'noframes': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'noscript': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'object': [ \ ['param', 'p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['top', 'middle', 'bottom', 'left', 'right'], 'name': [], 'data': [], 'declare': ['BOOL'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'type': [], 'width': [], 'usemap': [], 'dir': ['ltr', 'rtl'], 'vspace': [], 'tabindex': [], 'standby': [], 'archive': [], 'classid': [], 'style': [], 'onmousemove': [], 'onmouseout': [], 'height': [], 'border': [], 'codetype': [], 'hspace': [], 'codebase': []} \ ], \ 'ol': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': [], 'class': [], 'title': [], 'onclick': [], 'start': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'optgroup': [ \ ['option'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'option': [ \ [''], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'value': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'label': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': [], 'selected': ['BOOL']} \ ], \ 'p': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify'], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'param': [ \ [], \ { 'id': [], 'value': [], 'name': [], 'type': [], 'valuetype': ['DATA', 'REF', 'OBJECT']} \ ], \ 'pre': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'br', 'script', 'map', 'q', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'width': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'q': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'cite': [], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 's': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'samp': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'script': [ \ [], \ { 'src': [], 'for': [], 'charset': [], 'event': [], 'type': [], 'defer': ['BOOL'], 'language': []} \ ], \ 'select': [ \ ['optgroup', 'option'], \ { 'ondblclick': [], 'onkeydown': [], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'disabled': ['BOOL'], 'dir': ['ltr', 'rtl'], 'size': [], 'onblur': [], 'onfocus': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'multiple': ['BOOL']} \ ], \ 'small': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'span': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strike': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'strong': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'style': [ \ [], \ { 'media': [], 'lang': [], 'type': [], 'title': [], 'dir': ['ltr', 'rtl']} \ ], \ 'sub': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'sup': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'table': [ \ ['caption', 'col', 'colgroup', 'thead', 'tfoot', 'tbody'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'datapagesize': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'frame': ['void', 'above', 'below', 'hsides', 'lhs', 'rhs', 'vsides', 'box', 'border'], 'rules': ['none', 'groups', 'rows', 'cols', 'all'], 'dir': ['ltr', 'rtl'], 'summary': [], 'bgcolor': [], 'cellspacing': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'border': [], 'cellpadding': []} \ ], \ 'tbody': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'td': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'textarea': [ \ [''], \ { 'ondblclick': [], 'cols': [], 'onkeydown': [], 'readonly': ['BOOL'], 'onchange': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'name': [], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'accesskey': [], 'disabled': ['BOOL'], 'rows': [], 'dir': ['ltr', 'rtl'], 'onblur': [], 'onfocus': [], 'onselect': [], 'tabindex': [], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'tfoot': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'th': [ \ ['p', 'h1', 'h2', 'h3', 'h4', 'h5', 'h6', 'ul', 'ol', 'dir', 'menu', 'pre', 'dl', 'div', 'center', 'noscript', 'noframes', 'blockquote', 'form', 'isindex', 'hr', 'table', 'fieldset', 'address', 'tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'axis': [], 'onkeydown': [], 'abbr': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'scope': ['row', 'col', 'rowgroup', 'colgroup'], 'onmouseover': [], 'lang': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'width': [], 'headers': [], 'nowrap': ['BOOL'], 'dir': ['ltr', 'rtl'], 'rowspan': ['1'], 'colspan': ['1'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'height': [], 'char': []} \ ], \ 'thead': [ \ ['tr'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'title': [ \ [''], \ { 'lang': [], 'dir': ['ltr', 'rtl']} \ ], \ 'tr': [ \ ['th', 'td'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'align': ['left', 'center', 'right', 'justify', 'char'], 'lang': [], 'valign': ['top', 'middle', 'bottom', 'baseline'], 'onkeypress': [], 'onmousedown': [], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'bgcolor': [], 'charoff': [], 'onmouseout': [], 'onmousemove': [], 'style': [], 'char': []} \ ], \ 'tt': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'u': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'ul': [ \ ['li'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'compact': ['BOOL'], 'onmouseover': [], 'lang': [], 'onkeypress': [], 'onmousedown': [], 'type': ['disc', 'square', 'circle'], 'class': [], 'title': [], 'onclick': [], 'dir': ['ltr', 'rtl'], 'onmouseout': [], 'onmousemove': [], 'style': []} \ ], \ 'var': [ \ ['tt', 'i', 'b', 'u', 's', 'strike', 'big', 'small', 'em', 'strong', 'dfn', 'code', 'samp', 'kbd', 'var', 'cite', 'abbr', 'acronym', 'a', 'img', 'applet', 'object', 'font', 'basefont', 'br', 'script', 'map', 'q', 'sub', 'sup', 'span', 'bdo', 'iframe', 'input', 'select', 'textarea', 'label', 'button'], \ { 'ondblclick': [], 'onkeydown': [], 'onkeyup': [], 'onmouseup': [], 'id': [], 'onmouseover': [], 'lang': [], 'onmousedown': [], 'onkeypress': [], 'onclick': [], 'title': [], 'class': [], 'dir': ['ltr', 'rtl'], 'style': [], 'onmousemove': [], 'onmouseout': []} \ ], \ 'vimxmlattrinfo' : { \ 'accept' : ['ContentType', ''], \ 'accesskey' : ['Character', ''], \ 'action' : ['*URI', ''], \ 'align' : ['String', ''], \ 'alt' : ['*Text', ''], \ 'archive' : ['UriList', ''], \ 'axis' : ['CDATA', ''], \ 'border' : ['Pixels', ''], \ 'cellpadding' : ['Length', ''], \ 'cellspacing' : ['Length', ''], \ 'char' : ['Character', ''], \ 'charoff' : ['Length', ''], \ 'charset' : ['LangCode', ''], \ 'checked' : ['Bool', ''], \ 'class' : ['CDATA', ''], \ 'codetype' : ['ContentType', ''], \ 'cols' : ['*Number', ''], \ 'colspan' : ['Number', ''], \ 'content' : ['*CDATA', ''], \ 'coords' : ['Coords', ''], \ 'data' : ['URI', ''], \ 'datetime' : ['DateTime', ''], \ 'declare' : ['Bool', ''], \ 'defer' : ['Bool', ''], \ 'dir' : ['String', ''], \ 'disabled' : ['Bool', ''], \ 'enctype' : ['ContentType', ''], \ 'for' : ['ID', ''], \ 'headers' : ['IDREFS', ''], \ 'height' : ['Number', ''], \ 'href' : ['*URI', ''], \ 'hreflang' : ['LangCode', ''], \ 'id' : ['ID', ''], \ 'ismap' : ['Bool', ''], \ 'label' : ['*Text', ''], \ 'lang' : ['LangCode', ''], \ 'longdesc' : ['URI', ''], \ 'maxlength' : ['Number', ''], \ 'media' : ['MediaDesc', ''], \ 'method' : ['String', ''], \ 'multiple' : ['Bool', ''], \ 'name' : ['CDATA', ''], \ 'nohref' : ['Bool', ''], \ 'onblur' : ['Script', ''], \ 'onchange' : ['Script', ''], \ 'onclick' : ['Script', ''], \ 'ondblclick' : ['Script', ''], \ 'onfocus' : ['Script', ''], \ 'onkeydown' : ['Script', ''], \ 'onkeypress' : ['Script', ''], \ 'onkeyup' : ['Script', ''], \ 'onload' : ['Script', ''], \ 'onmousedown' : ['Script', ''], \ 'onmousemove' : ['Script', ''], \ 'onmouseout' : ['Script', ''], \ 'onmouseover' : ['Script', ''], \ 'onmouseup' : ['Script', ''], \ 'onreset' : ['Script', ''], \ 'onselect' : ['Script', ''], \ 'onsubmit' : ['Script', ''], \ 'onunload' : ['Script', ''], \ 'profile' : ['URI', ''], \ 'readonly' : ['Bool', ''], \ 'rel' : ['LinkTypes', ''], \ 'rev' : ['LinkTypes', ''], \ 'rows' : ['*Number', ''], \ 'rules' : ['String', ''], \ 'scheme' : ['CDATA', ''], \ 'selected' : ['Bool', ''], \ 'shape' : ['Shape', ''], \ 'size' : ['CDATA', ''], \ 'span' : ['Number', ''], \ 'src' : ['*URI', ''], \ 'standby' : ['Text', ''], \ 'style' : ['StyleSheet', ''], \ 'summary' : ['*Text', ''], \ 'tabindex' : ['Number', ''], \ 'title' : ['Text', ''], \ 'type' : ['*ContentType', ''], \ 'usemap' : ['URI', ''], \ 'valign' : ['String', ''], \ 'valuetype' : ['String', ''], \ 'width' : ['Number', ''], \ 'xmlns' : ['URI', ''] \ }, \ 'vimxmltaginfo': { \ 'area': ['/>', ''], \ 'base': ['/>', ''], \ 'basefont': ['/>', ''], \ 'br': ['/>', ''], \ 'col': ['/>', ''], \ 'hr': ['/>', ''], \ 'img': ['/>', ''], \ 'input': ['/>', ''], \ 'isindex': ['/>', ''], \ 'link': ['/>', ''], \ 'meta': ['/>', ''], \ 'param': ['/>', ''], \ } \ } PKN\RRetree/cElementTree.pynu[# Deprecated alias for xml.etree.ElementTree from xml.etree.ElementTree import * PKN\~h@eCeC3etree/__pycache__/ElementPath.cpython-311.opt-1.pycnu[ !A?h6ddlZejdZddZdZdZdZdZdZd Z d Z d Z d Z eee e e e d Z iZGddZddZddZddZddZdS)Nz`('[^']*'|\"[^\"]*\"|::|//?|\.\.|\(\)|!=|[/.*:\[\]\(\)@=])|((?:\{[^}]+\})?[^/\[\]\(\)@!=\s]+)|\s+c#K|r|dnd}d}t|D]}|\}}|r|ddkrsd|vrW|dd\}} |st|d||d|fVn6#t$rt d|zdwxYw|r|s |d|d|fVn|Vd}|V|d k}dS) NFr{:}z!prefix %r not found in prefix map@)getxpath_tokenizer_refindallsplitKeyError SyntaxError) pattern namespacesdefault_namespaceparsing_attributetokenttypetagprefixuris B/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementPath.pyxpath_tokenizerrJsY.8B r***d#++G44-- s  -3q6S==czz!iiQ// ^%'&%Z-?-?-?!EEEEEE^^^%&IF&RSSY]]^" +< e):):):CC@@@@@@ %  KKK %  %--s +BB%cv|j}|/ix|_}|jD] }|D]}|||< |SN) parent_maprootiter)contextrpes rget_parent_mapr#bs_#J*,,Z""$$ " "A " " ! 1  " c:|dddkp |dddkS)N{*}}*rs r_is_wildcard_tagr,ls' rr7e  /s233x4//r$cttcdkrfd}ndkrfd}ndddkr<ddtt dddfd}nPd dd kr0dd tdtfd }nt d |S)Nz{*}*c3@K|D]}|jr|VdSrr+)r resultelem _isinstance_strs rselectz_prepare_tag..selectvs@  ;tx..JJJ  r$z{}*c3\K|D]%}|j}|r|ddkr|V&dS)Nrrr+)r r/r0el_tagr1r2s rr3z_prepare_tag..select|sS  ;vt,,c1A1AJJJ  r$r&r'c3hK|D]+}|j}|ks|r|kr|V,dSrr+) r r/r0r5r1r2no_nssuffixrs rr3z_prepare_tag..selectsY  S==KK$=$==&-SYBYBYJJJ  r$r(r)c3\K|D]%}|j}|r|kr|V&dSrr+)r r/r0r5r1r2nsns_onlys rr3z_prepare_tag..selectsS  ;vt,,B1F1FJJJ  r$zinternal parser error, got ) isinstancestrslicelen RuntimeError)rr3r1r2r8r<r=r9s` @@@@@@r _prepare_tagrCpsi"CK f}}                RaRE  QRRs6{{lD))!""g           RSST   "Xc"gg&&          >>>??? Mr$c|dtrtfd}ndddkr ddfd}|S)Nrc4d}|||S)Nc3$K|D] }|Ed{V dSrr*)r/r0s r select_childz3prepare_child..select..select_childs2"$$D#OOOOOOOO$$r$r*r r/rG select_tags rr3zprepare_child..selects0 $ $ $:g||F';';<< K|D]}|D]}|jkr|VdSrr+r r/r0r"rs rr3zprepare_child..selectsI    Au||   r$)r,rCnextrr3rIrs @@r prepare_childrOs (C !#&&  = = = = = = rr7d??abb'C     Mr$c d}|S)Nc3$K|D] }|Ed{V dSrr*)r r/r0s rr3zprepare_star..selects2  DOOOOOOOO  r$r*rNrr3s r prepare_starrSs Mr$c d}|S)Nc3K|Ed{VdSrr*)r r/s rr3zprepare_self..selects$r$r*rRs r prepare_selfrVs Mr$c$ |}n#t$rYdSwxYw|ddkrdn |ds |dntdtrtfd}ndddkr ddfd}|S) Nr*rzinvalid descendantc4d}|||S)Nc3RK|D]!}|D] }||ur|V "dSrr)r/r0r"s rrGz8prepare_descendant..select..select_childsN"$$D!YY[[$$D=="#GGG$$$r$r*rHs rr3z"prepare_descendant..selects0 $ $ $ :g||F';';<< .selectsQ  3  A}}   r$) StopIterationrr,rCrMs @@rprepare_descendantr^s  Qx3 1X0Ah./// !#&&  = = = = = = rr7d??abb'C     Ms  c d}|S)Nc3hKt|}i}|D]}||vr||}||vr d||<|VdSr)r#)r r/r result_mapr0parents rr3zprepare_parent..selectse#G,,   ! !Dz!!#D)++)-Jv& LLL  ! !r$r*rRs rprepare_parentrcs ! ! ! Mr$c g}g} |}n#t$rYdSwxYw|ddkrnl|dkr2|dr$|ddddvrd|dddf}||dpd||dd |}|d kr|dfd }|S|d ks|d kr$|d|d  fd} fd}d|vr|n|S|dkr*tjd|ds|dfd}|S|dks-|dks'|dks|dkrLtjd|ds1|d|d r  fd} fd}n fd} fd}d|vr|n|S|dks |dks|dkr|dkr.t |ddz dkrt dnp|ddkrt d|dkrM t |d dz n#t$rt d!wxYwd"krt d#ndfd$}|St d%)&Nrr])rrz'"'r:-rz@-c3HK|D]}||VdSrr )r r/r0keys rr3z!prepare_predicate..selects:  88C==,JJJ  r$z@-='z@-!='c3PK|D]}|kr|V dSrri)r r/r0rjvalues rr3z!prepare_predicate..selects?  88C==E))JJJ  r$c3XK|D]#}|x} |kr|V$dSrri)r r/r0 attr_valuerjrls rselect_negatedz)prepare_predicate..select_negatedsI  "&((3--/J<uATATJJJ  r$z!=z\-?\d+$c3HK|D]}||VdSr)find)r r/r0rs rr3z!prepare_predicate..selects:  99S>>-JJJ  r$z.='z.!='z-='z-!='c3K|D]K}|D]3}d|kr|Vn4LdSNr)r joinitertextr r/r0r"rrls rr3z!prepare_predicate..selectsn"""D!\\#..""771::<<00E99"&JJJ!E:""r$c3K|D]K}|D]3}d|kr|Vn4LdSrs)iterfindrtrurvs rroz)prepare_predicate..select_negated"sn"""D!]]3//""771::<<00E99"&JJJ!E:""r$c3tK|D]1}d|kr|V2dSrsrtrur r/r0rls rr3z!prepare_predicate..select)I"##Dwwt}}//588" ##r$c3tK|D]1}d|kr|V2dSrsrzr{s rroz)prepare_predicate..select_negated-r|r$z-()z-()-zXPath position >= 1 expectedlastzunsupported functionr6zunsupported expressionr(z)XPath offset from last() must be negativec3Kt|}|D]W} ||}t||j}||ur|VA#tt f$rYTwxYwdSr)r#listr r IndexErrorr)r r/rr0rbelemsindexs rr3z!prepare_predicate..selectEs'00J  '-F !9!9::EU|t++" "H-D  s=AA*)A*zinvalid predicate)r]appendrtrematchintr ValueError) rNr signature predicater3rorrjrrls @@@@rprepare_predicatersII # DFFEE    FF  8s??  H    8 (a! --q!B$'EqS)))q""" # ""IDl      Fi722l"             "&!2!2~~>CYq\ B Bl      EY&00 %  9#6#6HZ166$7l"   # " " " " " "  " " " " " " " # # # # # # # # # #"&!2!2~~>C9--f1D1D    ! %%)Eqyy!"@AAA|v%%!"8999F""@ ! --1EE!@@@%&>???@2::%&QRRR      ) * **s  $$6HH))rrX.z..z//[ceZdZdZdZdS)_SelectorContextNc||_dSr)r)selfrs r__init__z_SelectorContext.__init__`s  r$)__name__ __module__ __qualname__rrr*r$rrr^s(Jr$rcZ|dddkr|dz}|f}|r1|tt|z } t|}n.#t$r t tdkrt|dddkrtdtt||j } |}n#t$rYYdSwxYwg} | t|d||n#t$rtddwxYw |}|ddkr |}n#t$rYnwxYw|t|<YnwxYw|g}t|}|D]} | ||}|S) Nr:/rXdrz#cannot use absolute path on elementrz invalid path)tuplesorteditems_cacherrAclearrrr__next__r]ropsr) r0pathr cache_keyselectorrNrr/r r3s rrxrxhs  BCCyCczI7U6*"2"2"4"455666 %)$ %%% v;;   LLNNN 8s??CDD DOD*5566? DFFEE    FFF   <E!H dE : :;;;;  < < <!.11t; < 8s?? DFFE      %y-%0VFt$$G))(( Mss AA;F C! F! C0+F/C00F7/D'&F'EF E'&F' E41F3E44FFc@tt|||dSr)rNrxr0rrs rrqrqs tZ00$ 7 77r$c>tt|||Sr)rrxrs rr r s tZ00 1 11r$c tt|||}|jdS|jS#t$r|cYSwxYwrs)rNrxtextr])r0rdefaultrs rfindtextrsYHT44455 9 2y s%00 ??r)NN)rcompiler rr#r,rCrOrSrVr^rcrrrrrxrqr rr*r$rrstv RZ    ----0000&&&R&  >   n+n+n+b        ''''X8888 2222 r$PKN\xTK""6etree/__pycache__/ElementInclude.cpython-311.opt-2.pycnu[ !A?hddlZddlmZddlmZdZedzZedzZdZGd d e Z Gd d e Z dd Z ddefdZ dZdS)N) ElementTree)urljoinz!{http://www.w3.org/2001/XInclude}includefallbackceZdZdS)FatalIncludeErrorN__name__ __module__ __qualname__E/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementInclude.pyr r CDrr ceZdZdS)LimitedRecursiveIncludeErrorNr rrrrrGrrrc4|dkrOt|d5}tj|}dddn #1swxYwYnB|sd}t|d|5}|}dddn #1swxYwY|S)NxmlrbzUTF-8r)encoding)openrparsegetrootread)hrefrrfiledatas rdefault_loaderr!Ws ~~ $   5$T**2244D 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 H $h / / / 499;;D                Ks#'A  AA,B  BBc|d}n|dkrtd|zt|dr|}|t}t ||||t dS)Nrz;expected non-negative depth or None for 'max_depth', got %rr) ValueErrorhasattrrr!_includeset)elemloaderbase_url max_depths rrrtsv QVYbbccctY||~~ ~ T68Y66666rcNd}|t|kr||}|jtkr|d}|rt ||}|dd}|dkr||vrt d|z|dkrt d|z|||||} | t d|d|tj| } t| |||d z || ||j r| j pd |j z| _ | ||<n|d kr}||||d } | t d|d||j r | |j z } |r||d z } | j pd | z| _ n|j pd | z|_ ||=t d |z|jtkrt d|jzt||||||d z }|t|k dSdS)Nrrrrzrecursive include of %sz5maximum xinclude depth reached when including file %sz cannot load z as rtextrz)unknown parse type in xi:include tag (%r)z0xi:fallback tag must be child of xi:include (%r))lentagXINCLUDE_INCLUDEgetrr raddcopyr&removetailr.XINCLUDE_FALLBACK) r(r)r*r+ _parent_hrefsierrnoder.s rr&r&s A c$ii-- G 5$ $ $55==D /x..EE'5))E~~=((+,E,LMMM>>6ORVVXXX!!$'''vdE**<++26$$>yvtY]MJJJ$$T***6;!%bAF :DIQ&vdE155+<+<==<++26$$>6#AFND9!9D!%bD 8DII!%bD 8DIG'?%GU' ' '#BQUJ  Q)] C C C Qg c$ii------r)N)r4r-r urllib.parserXINCLUDEr1r7DEFAULT_MAX_INCLUSION_DEPTH SyntaxErrorr rr!rr&rrrr@sf  .i'z)               #4      :1 7 7 7 766666rPKN\xTK""6etree/__pycache__/ElementInclude.cpython-311.opt-1.pycnu[ !A?hddlZddlmZddlmZdZedzZedzZdZGd d e Z Gd d e Z dd Z ddefdZ dZdS)N) ElementTree)urljoinz!{http://www.w3.org/2001/XInclude}includefallbackceZdZdS)FatalIncludeErrorN__name__ __module__ __qualname__E/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementInclude.pyr r CDrr ceZdZdS)LimitedRecursiveIncludeErrorNr rrrrrGrrrc4|dkrOt|d5}tj|}dddn #1swxYwYnB|sd}t|d|5}|}dddn #1swxYwY|S)NxmlrbzUTF-8r)encoding)openrparsegetrootread)hrefrrfiledatas rdefault_loaderr!Ws ~~ $   5$T**2244D 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 H $h / / / 499;;D                Ks#'A  AA,B  BBc|d}n|dkrtd|zt|dr|}|t}t ||||t dS)Nrz;expected non-negative depth or None for 'max_depth', got %rr) ValueErrorhasattrrr!_includeset)elemloaderbase_url max_depths rrrtsv QVYbbccctY||~~ ~ T68Y66666rcNd}|t|kr||}|jtkr|d}|rt ||}|dd}|dkr||vrt d|z|dkrt d|z|||||} | t d|d|tj| } t| |||d z || ||j r| j pd |j z| _ | ||<n|d kr}||||d } | t d|d||j r | |j z } |r||d z } | j pd | z| _ n|j pd | z|_ ||=t d |z|jtkrt d|jzt||||||d z }|t|k dSdS)Nrrrrzrecursive include of %sz5maximum xinclude depth reached when including file %sz cannot load z as rtextrz)unknown parse type in xi:include tag (%r)z0xi:fallback tag must be child of xi:include (%r))lentagXINCLUDE_INCLUDEgetrr raddcopyr&removetailr.XINCLUDE_FALLBACK) r(r)r*r+ _parent_hrefsierrnoder.s rr&r&s A c$ii-- G 5$ $ $55==D /x..EE'5))E~~=((+,E,LMMM>>6ORVVXXX!!$'''vdE**<++26$$>yvtY]MJJJ$$T***6;!%bAF :DIQ&vdE155+<+<==<++26$$>6#AFND9!9D!%bD 8DII!%bD 8DIG'?%GU' ' '#BQUJ  Q)] C C C Qg c$ii------r)N)r4r-r urllib.parserXINCLUDEr1r7DEFAULT_MAX_INCLUSION_DEPTH SyntaxErrorr rr!rr&rrrr@sf  .i'z)               #4      :1 7 7 7 766666rPKN\W0etree/__pycache__/__init__.cpython-311.opt-2.pycnu[ !A?hEdS)Nr?/opt/alt/python-internal/lib64/python3.11/xml/etree/__init__.pyrsrPKN\}_}_3etree/__pycache__/ElementTree.cpython-311.opt-1.pycnu[ !A?h"dZgdZdZddlZddlZddlZddlZddlZddlZddl Z ddl Z ddl m Z Gdde Zd ZGd d Zifd ZdDd ZdDdZeZGddZGddZe jdZdDdZdZhdZdZdZeeedZdZdddddd d!d"Z e e_ d#Z!d$Z"d%Z#d&Z$dEddd'd(d)Z%Gd*d+ej&Z'dEddd'd(d,Z(d-Z)dFd/Z*dDd0Z+dEd1Z,Gd2d3Z-dDd4Z.dDd5Z/e.Z0dDd6Z1Gd7d8Z2Gd9d:Z3dDddd;d<Z4ej5d=ej6j7Z8Gd>d?Z9d@Z:dAZ; eZZ>e>eedS#e?$rYdSwxYw)GaLightweight XML support for Python. XML is an inherently hierarchical data format, and the most natural way to represent it is with a tree. This module has two classes for this purpose: 1. ElementTree represents the whole XML document as a tree and 2. Element represents a single node in this tree. Interactions with the whole document (reading and writing to/from files) are usually done on the ElementTree level. Interactions with a single XML element and its sub-elements are done on the Element level. Element is a flexible container object designed to store hierarchical data structures in memory. It can be described as a cross between a list and a dictionary. Each Element has a number of properties associated with it: 'tag' - a string containing the element's name. 'attributes' - a Python dictionary storing the element's attributes. 'text' - a string containing the element's text content. 'tail' - an optional string containing text after the element's end tag. And a number of child elements stored in a Python sequence. To create an element instance, use the Element constructor, or the SubElement factory function. You can also use the ElementTree class to wrap an element structure and convert it to and from XML. )CommentdumpElement ElementTree fromstringfromstringlistindent iselement iterparseparse ParseErrorPIProcessingInstructionQName SubElementtostring tostringlist TreeBuilderVERSIONXMLXMLID XMLParser XMLPullParserregister_namespace canonicalizeC14NWriterTargetz1.3.0N) ElementPathceZdZdZdS)r zAn error when parsing an XML document. In addition to its exception value, a ParseError contains two extra attributes: 'code' - the specific exception code 'position' - the line and column of the error N)__name__ __module__ __qualname____doc__B/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementTree.pyr r ks Dr%r c"t|dS)z2Return True if *element* appears to be an Element.tag)hasattr)elements r&r r ys 7E " ""r%ceZdZdZdZ dZ dZ dZ ifdZdZ dZ dZ dZ dZ d Zd Zd Zd Zd ZdZdZdZdZddZddZddZddZdZddZdZdZdZddZ dZ!dS)rahAn XML element. This class is the reference implementation of the Element interface. An element's length is its number of subelements. That means if you want to check if an element is truly empty, you should check BOTH its length AND its text attribute. The element tag, attribute names, and attribute values can be either bytes or strings. *tag* is the element name. *attrib* is an optional dictionary containing element attributes. *extra* are additional element attributes given as keyword arguments. Example form: text...tail Nc t|tstd|jj||_i|||_g|_dS)Nzattrib must be dict, not ) isinstancedict TypeError __class__r r(attrib _children)selfr(r1extras r&__init__zElement.__init__s\&$'' -) )),-- -))5) r%cJd|jj|jt|fzS)Nz<%s %r at %#x>)r0r r(idr3s r&__repr__zElement.__repr__s!4>#:DHbhh"OOOr%c.|||S)zCreate a new element with the same type. *tag* is a string containing the element name. *attrib* is a dictionary containing the element attributes. Do not call this method, use the SubElement factory function instead. )r0)r3r(r1s r& makeelementzElement.makeelements~~c6***r%c^tjdt|S)zReturn copy of current element. This creates a shallow copy. Subelements will be shared with the original tree. z7elem.copy() is deprecated. Use copy.copy(elem) instead.)warningswarnDeprecationWarning__copy__r8s r&copyz Element.copys.  E    }}r%c||j|j}|j|_|j|_||dd<|SN)r;r(r1texttail)r3elems r&r@zElement.__copy__s?$+66I I QQQ r%c*t|jSrC)lenr2r8s r&__len__zElement.__len__s4>"""r%cjtjdtdt|jdkS)NzyThe behavior of this method will change in future versions. Use specific 'len(elem)' or 'elem is not None' test instead. stacklevelr)r=r> FutureWarningrHr2r8s r&__bool__zElement.__bool__s=  K a     4>""a''r%c|j|SrCr2r3indexs r& __getitem__zElement.__getitem__s~e$$r%ct|tr|D]}||n||||j|<dSrC)r-slice_assert_is_elementr2)r3rSr*elts r& __setitem__zElement.__setitem__sg eU # # - - -'',,,, -  # #G , , , 'ur%c|j|=dSrCrQrRs r& __delitem__zElement.__delitem__s N5 ! ! !r%cd|||j|dS)aAdd *subelement* to the end of this element. The new element will appear in document order after the last existing subelement (or directly after the text, if it's the first subelement), but before the end tag for this element. NrWr2appendr3 subelements r&r^zElement.appends4  +++ j)))))r%cn|D]1}|||j|2dS)zkAppend subelements from a sequence. *elements* is a sequence with zero or more elements. Nr])r3elementsr*s r&extendzElement.extendsJ   + +G  # #G , , , N ! !' * * * * + +r%cf|||j||dS)z(Insert *subelement* at position *index*.N)rWr2insert)r3rSr`s r&rezElement.inserts4  +++ eZ00000r%cxt|ts$tdt|jzdS)Nzexpected an Element, not %s)r- _Element_Pyr/typer )r3es r&rWzElement._assert_is_elements@![)) N9DGG)r0r rDr8s r&r9zQName.__repr__s  N333TYYY??r%c*t|jSrC)hashrDr8s r&__hash__zQName.__hash__sDIr%cbt|tr|j|jkS|j|kSrCr-rrDr3others r&__le__z QName.__le__0 eU # # +9 * *yE!!r%cbt|tr|j|jkS|j|kSrCrrs r&__lt__z QName.__lt__0 eU # # *9uz) )y5  r%cbt|tr|j|jkS|j|kSrCrrs r&__ge__z QName.__ge__rr%cbt|tr|j|jkS|j|kSrCrrs r&__gt__z QName.__gt__rr%cbt|tr|j|jkS|j|kSrCrrs r&__eq__z QName.__eq__rr%rC) r r!r"r#r5rr9rrrrrrr$r%r&rrs      @@@"""!!!"""!!!"""""r%rcreZdZdZddZdZdZddZddZddZ dd Z dd Z dd Z dd d dZ dZdS)ra%An XML element hierarchy. This class also provides support for serialization to and from standard XML. *element* is an optional root element node, *file* is an optional file handle or file name of an XML file whose contents will be used to initialize the tree with. NcF||_|r||dSdSrC)_rootr )r3r*files r&r5zElementTree.__init__s3   JJt       r%c|jS)z!Return root element of this tree.rr8s r&getrootzElementTree.getroots zr%c||_dS)zReplace root element of this tree. This will discard the current contents of the tree and replace it with the given element. Use with care! Nr)r3r*s r&_setrootzElementTree._setroot#s r%cd}t|dst|d}d} |Vt}t|dr8|||_|j|r|SS |d}|sn||.||_|j|r|SS#|r|wwxYw)a=Load external XML document into element tree. *source* is a file name or file object, *parser* is an optional parser instance that defaults to XMLParser. ParseError is raised if the parser fails to parse the document. Returns the root element of the given source document. FreadrbTN _parse_wholei)r)openrrrcloserfeed)r3sourceparser close_sourcedatas r&r zElementTree.parse-s vv&& &$''FL ~"6>22& "(!4!4V!AC$$C=c6|j|S)zCreate and return tree iterator for the root element. The iterator loops over all elements in this tree, in document order. *tag* is a string with the tag name to iterate over (default is to return all elements). )rrr3r(s r&rzElementTree.iterRszs###r%c|dddkr$d|z}tjd|ztd|j||S)a\Find first matching element by tag name or path. Same as getroot().find(path), which is Element.find() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. Nr/.This search is broken in 1.3 and earlier, and will be fixed in a future version. If you rely on the current behaviour, change it to %rrKrL)r=r>rNrrmrns r&rmzElementTree.find^sc 8s??:D M-/34!      ztZ000r%c|dddkr$d|z}tjd|ztd|j|||S)aeFind first matching element by tag name or path. Same as getroot().findtext(path), which is Element.findtext() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. NrrrrrKrL)r=r>rNrrrrss r&rrzElementTree.findtexttsg 8s??:D M-/34!      z""4*===r%c|dddkr$d|z}tjd|ztd|j||S)aaFind all matching subelements by tag name or path. Same as getroot().findall(path), which is Element.findall(). *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return list containing all matching elements in document order. NrrrrrKrL)r=r>rNrrvrns r&rvzElementTree.findallse 8s??:D M-/34!      z!!$ 333r%c|dddkr$d|z}tjd|ztd|j||S)agFind all matching subelements by tag name or path. Same as getroot().iterfind(path), which is element.iterfind() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return an iterable yielding all matching elements in document order. NrrrrrKrL)r=r>rNrrxrns r&rxzElementTree.iterfindse 8s??:D M-/34!      z""4444r%Tshort_empty_elementsc|sd}n|tvrtd|z|s |dkrd}nd}t||5\}}|dkrA|s0|=|dkr%|dvr|d |d |d krt ||jn:t |j|\} } t|} | ||j| | | ddddS#1swxYwYdS) aWrite element tree to a file as XML. Arguments: *file_or_filename* -- file name or a file object opened for writing *encoding* -- the output encoding (default: US-ASCII) *xml_declaration* -- bool indicating if an XML declaration should be added to the output. If None, an XML declaration is added if encoding IS NOT either of: US-ASCII, UTF-8, or Unicode *default_namespace* -- sets the default XML namespace (for "xmlns") *method* -- either "xml" (default), "html, "text", or "c14n" *short_empty_elements* -- controls the formatting of elements that contain no content. If True (default) they are emitted as a single self-closed tag, otherwise they are emitted as a pair of start/end tags xmlzunknown method %rc14nutf-8us-asciiNunicode)rrz rDr) _serialize ValueError _get_writerlower_serialize_textr _namespaces) r3file_or_filenameencodingxml_declarationdefault_namespacemethodrwritedeclared_encodingqnamesrp serializes r&rzElementTree.writes: ;FF : % %069:: : &"% )8 4 4 E8R@QO$,^^%%22&,,..6KKK%%%()))tz2222%0=N%O%O" &v.  %VZ/CEEEE E E E E E E E E E E E E E E E E E EsB!C,,C03C0c0||dS)Nr)r)r)r3rs r& write_c14nzElementTree.write_c14nszz$vz...r%rrC)NNNN)r r!r"r#r5rrr rrmrrrvrxrrr$r%r&rrs   ####J $ $ $ $1111,>>>>,4444,5555." $ 3E $( 3E3E3E3E3Ej/////r%rc#xK |j}|dkr|t|ddpdfVdStj5}t |t jr|}nt |t jr/t j |}| |j nLt j}d|_ ||_ |j |_ |j|_n#t$rYnwxYwt j||dd}| |j |j|fVddddS#1swxYwYdS#t$rV|dkrd}t#|d|d 5}|j|fVdddYdS#1swxYwYYdSwxYw) NrrrcdSNTr$r$r%r&z_get_writer..sDr%xmlcharrefreplace )rerrorsnewlinew)rr)rrgetattr contextlib ExitStackr-ioBufferedIOBase RawIOBaseBufferedWritercallbackdetachwritableseekabletellAttributeError TextIOWrapperr)rrrstackrs r&rrs-+ & >>  y ( (!1:tDDOO O O O O O%'' +5.0ABB+DD 0",??,-=>>DNN4;////,..D$0LDM!&DJ)9(A $4$9 )'19/B04666 t{+++j(****9 + + + + + + + + + + + + + + + + + + ''' >>  y ( (H "C(,... '15*h& & & & ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' 'smEB E C21E 2 C?<E >C??AE  EE7F9 F* F9*F. .F91F. 2F98F9cddiird<fd}|D])}|j}t|tr|jvr||jnHt|t r|vr ||n#|!|t ur|turt|| D]^\}}t|tr|j}|vr ||t|tr|jvr||j_|j}t|tr|jvr||j+fS)Nc |dddkr|dddd\}}|}|9t|}|dtz}|dkr||<|r |d||<dS||<dSrt d||<dS#t $rt |YdSwxYw)Nrrrzns%dr:z.add_qname/s .RaRyC 9++C33S#,,>+//44F~!'#j//!9*0 3(/5vvss$;F5MMM$'F5MMM$$3!&u  . . . &u - - - - - - .sB B/B/B//C  C ) rr(r-rrDrrr rr) rFrrr(r}rrDrprs ` @@r&rr$sD\FJ+(* $%.......8 !!h c5 ! ! ,xv%% #(### S ! ! ,&   # _G!3!32 &s + + +**,, & &JC#u%% h&   #%'' &EJf,D,D %*%%%y dE " " !ty'>'> Idi : r%c |j}|j}|tur|d|zn|tur|d|zn||}|5|r|t ||D]}t |||d|na|d|zt |} | s|r|rPt|dD]+\} } | rd| z} |d| d t| d ,| D]k\} } t| tr| j} t| tr|| j} nt| } |d || d | d l|st|s|sP|d |r|t ||D]}t |||d||d |zd zn |d|j r|t |j dSdS)N rrc|dSNrr$xs r&rz _serialize_xml..w QqTr%r}r xmlns=""rr)r(rDrr _escape_cdata_serialize_xmllistrsorted_escape_attribr-rrHrE) rrFrrprkwargsr(rDrirvks r&rras (C 9D g~~ kD !!!! % % % hoSk ; +mD))*** J Jua4HJJJJJ J E#)   &&E 9  9 &z'7'7'9'9+9>!;!;!;1( #aAAA*1----"99DAq!!U++#F!!U++."16N*1--EE&)))QQQ78888 s4yy (< c /E---...NNA"5!VT8LNNNNNdSj3&''''e  y( mDI&&'''''((r%>brhrcolimgwbrareabaselinkmetaembedframeinputparamtrackrisindexbasefontc j|j}|j}|tur|dt|zn|tur|dt|zn||}|3|r|t||D]}t |||dnu|d|zt |}|s|r|rPt|dD]+\} } | rd| z} |d| dt| d ,|D]k\} } t| tr| j} t| tr|| j} nt| } |d || d| d l|d | } |r0| d ks| d kr ||n|t||D]}t |||d| tvr|d|zd z|jr|t|jdSdS)Nr r rc|dSr r$rs r&rz!_serialize_html..rr%rrrrrrrscriptstyler)r(rDrrr_serialize_htmlrrrrr-r_escape_attrib_htmlr HTML_EMPTYrE) rrFrrprr(rDrirrrltags r&r2r2s (C 9D g~~ kM$///0000 % % % ht,,,----Sk ; +mD))*** 8 8q&$7777 8 E#)   &&E 9  9 &z'7'7'9'9+9>!;!;!;1( #aAAA*1----"99DAq!!U++#F!!U++3"16N/22EE&)))QQQ78888 E#JJJ99;;D /8##twE$KKKKE---... 8 8q&$7777:%%dSj3&''' y( mDI&&'''''((r%c||D] }|||jr||jdSdSrC)rrE)rrFparts r&rrsT  d  y dir%)rhtmlrDctjd|rtdttD]\}}||ks||krt|=|t|<dS)atRegister a namespace prefix. The registry is global, and any existing mapping for either the given prefix or the namespace URI will be removed. *prefix* is the namespace prefix, *uri* is a namespace uri. Tags and attributes in this namespace will be serialized with prefix if possible. ValueError is raised if prefix is reserved or is invalid. zns\d+$z'Prefix format reserved for internal useN)rematchrrrr)rrrrs r&rrsy x 6""DBCCC^))++,,""1 88qF{{q! N3r%rr8rdfwsdlxsxsidc)$http://www.w3.org/XML/1998/namespacezhttp://www.w3.org/1999/xhtmlz+http://www.w3.org/1999/02/22-rdf-syntax-ns#z http://schemas.xmlsoap.org/wsdl/z http://www.w3.org/2001/XMLSchemaz)http://www.w3.org/2001/XMLSchema-instancez http://purl.org/dc/elements/1.1/cRtd|dt|jd)Nzcannot serialize z (type ))r/rhr rs r&rrs1 )+/44d1D1D1DE   r%c d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw)N&&r<r>replacer/rrrs r&rrs ) $;;<<W--D $;;<<V,,D $;;<<V,,D ~ &)))"4(((((()AA A65A6c d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}d |vr|d d }d |vr|d d }d |vr|d d}|S#ttf$rt|YdSwxYw)NrErFrrGrrHr" z rz  z rIrs r&rrs ) $;;<<W--D $;;<<V,,D $;;<<V,,D 4<<<<h//D 4<<<<g..D 4<<<<g..D 4<<<<g..D ~ &)))"4(((((()sB7B:: CCc d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw)NrErFrrHrrMrIrs r&r3r3+s ) $;;<<W--D $;;<<V,,D 4<<<<h//D ~ &)))"4(((((()rKT)rrrc|dkrtjntj}t||||||||S)a Generate string representation of XML element. All subelements are included. If encoding is "unicode", a string is returned. Otherwise a bytestring is returned. *element* is an Element instance, *encoding* is an optional output encoding defaulting to US-ASCII, *method* is an optional output which can be one of "xml" (default), "html", "text" or "c14n", *default_namespace* sets the default XML namespace (for "xmlns"). Returns an (optionally) encoded string containing the XML data. rrrrr)rStringIOBytesIOrrgetvalue)r*rrrrrstreams r&rr:sm ')33R[]]]Fvx/>1B&,4H JJJ ??  r%c0eZdZdZdZdZdZdZdZdS)_ListDataStreamz7An auxiliary stream accumulating into a list reference.c||_dSrC)lst)r3rZs r&r5z_ListDataStream.__init__Ts r%cdSrr$r8s r&rz_ListDataStream.writableWtr%cdSrr$r8s r&rz_ListDataStream.seekableZr\r%c:|j|dSrC)rZr^)r3bs r&rz_ListDataStream.write]s r%c*t|jSrC)rHrZr8s r&rz_ListDataStream.tell`s48}}r%N) r r!r"r#r5rrrrr$r%r&rXrXRseAAr%rXcxg}t|}t||||||||S)NrR)rXrr)r*rrrrrrZrVs r&rrcsU C S ! !Fvx/>1B&,4H JJJ Jr%c t|tst|}|tjd|j}|r |ddkr!tjddSdS)a#Write element tree or element structure to sys.stdout. This function should be used for debugging only. *elem* is either an ElementTree, or a single Element. The exact output format is implementation dependent. In this version, it's written as an ordinary XML file. r)rrN)r-rrsysstdoutrrE)rFrEs r&rrps dK ( (!4  JJszIJ... <<>> D 48t## $#r% ct|tr|}|dkrtd|t |sdSd|zzgfd|ddS)a&Indent an XML document by inserting newlines and indentation space after elements. *tree* is the ElementTree or Element to modify. The (root) element itself will not be changed, but the tail text of all elements in its subtree will be adapted. *space* is the whitespace to insert for each indentation level, two space characters by default. *level* is the initial indentation level. Setting this to a higher value than 0 can be used for indenting subtrees that are more deeply nested inside of a document. rz,Initial indentation level must be >= 0, got Nrc|dz} |}n0#t$r#|z}|YnwxYw|jr|js||_|D]D}t |r |||jr|js||_E|js||_dSdSr ) IndexErrorr^rDstriprHrE)rFlevel child_levelchild_indentationchild_indent_children indentationsspaces r&roz indent.._indent_childrensai  3 ,[ 9   3 3 3 ,U 3e ;     1 2 2 2 2 2 3y *  1 1 *)DI / /E5zz 5   444: /UZ%5%5%7%7 /. z!! -%e,EJJJ - -s *>>)r-rrrrH)treerqrkrorps ` @@r&rrs$ $$||~~ qyyOOOPPP t9955=()L-------,T1r%cNt}||||S)zParse XML document into element tree. *source* is a filename or file object containing XML data, *parser* is an optional parser instance defaulting to XMLParser. Return an ElementTree instance. )rr )rrrrs r&r r s& ==DJJvv Kr%ct||tdstddndfdGfddtjj}|}d |_tj||S) aJIncrementally parse XML document into ElementTree. This class also reports what's going on to the user based on the *events* it is initialized with. The supported events are the strings "start", "end", "start-ns" and "end-ns" (the "ns" events are used to get detailed namespace information). If *events* is omitted, only "end" events are reported. *source* is a filename or file object containing XML data, *events* is a list of events to report back, *parser* is an optional parser instance. Returns an iterator providing (event, elem) pairs. )events_parserrrTFc3K Ed{V|d}|sn|H}Ed{V}|||_r|dSdS#r|wwxYw)NTi@) read_eventsrr_close_and_return_rootrootr)rrrzitr pullparserwrs r&iteratorziterparse..iterators  &%11333333333{{9--%%%  &4466D!--// / / / / / / /B~    |   s B B))Cc<eZdZjZfdZdS)$iterparse..IterParseIteratorc8rdSdSrC)r)r3rrs r&__del__z,iterparse..IterParseIterator.__del__s&    r%N)r r!r"__next__r)rr~rsr&IterParseIteratorrsE8F##,        r%rN) rr)r collectionsabcIteratorrzweakrefref) rrurrr{rr~r|r}s ` @@@@r&r r s"ff===J 66 " "fd##  $KO4    BBG RB Ir%c:eZdZd dddZdZdZdZdZdZdS) rN)rvctj|_|ptt |_|d}|j|j|dS)Nr)end)rdeque _events_queuerrrv _setevents)r3rurvs r&r5zXMLPullParser.__init__s[ ).00A);=="A"A"A >F  2F;;;;;r%c|jtd|rO |j|dS#t$r%}|j|Yd}~dSd}~wwxYwdS)Feed encoded data to parser.Nz!feed() called after end of stream)rvrr SyntaxErrorrr^)r3rexcs r&rzXMLPullParser.feed s < @AA A  / / !!$''''' / / /"))#......... / / /s6 A%A  A%cF|j}d|_|SrC)rvr)r3rzs r&ryz$XMLPullParser._close_and_return_roots!|!!##  r%c.|dS)zFinish feeding data to parser. Unlike XMLParser, does not return the root element. Use read_events() to consume elements from XMLPullParser. N)ryr8s r&rzXMLPullParser.closes ##%%%%%r%c#K|j}|r3|}t|tr||V|1dSdS)zReturn an iterator over currently available (event, elem) pairs. Events are consumed from the internal event queue as they are retrieved from the iterator. N)rpopleftr- Exception)r3ruevents r&rxzXMLPullParser.read_events%se # NN$$E%++        r%cd|jtd|jdS)Nz"flush() called after end of stream)rvrflushr8s r&rzXMLPullParser.flush3s3 < ABB B r%rC) r r!r"r5rryrrxrr$r%r&rrs >r%c|stt}|||}i}|D]}|d}|r|||<||fS)aParse XML document from string constant for its IDs. *text* is a string containing XML data, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an (Element, dict) tuple, in which the dict maps element id:s to elements. rr7)rrrrrr|)rDrrridsrFr7s r&rrJs 1+--000 KK <<>>D C  XXd^^  CG 9r%c|stt}|D]}|||S)zParse XML document from sequence of string fragments. *sequence* is a list of other sequence, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an Element instance. rr)sequencerrDs r&rrbsR 1+--000 D <<>>r%cXeZdZdZdddddddZdZdZdZd Zd Z d Z dd Z d Z dS)ra8Generic element structure builder. This builder converts a sequence of start, data, and end method calls to a well-formed element structure. You can use this class to build an element structure using a custom XML parser, or a parser for some other XML-like format. *element_factory* is an optional element factory which is called to create new Element instances, as necessary. *comment_factory* is a factory to create comments to be used instead of the standard factory. If *insert_comments* is false (the default), comments will not be inserted into the tree. *pi_factory* is a factory to create processing instructions to be used instead of the standard factory. If *insert_pis* is false (the default), processing instructions will not be inserted into the tree. NF)comment_factory pi_factoryinsert_comments insert_piscg|_g|_d|_d|_d|_|t }||_||_|t}||_ ||_ |t}||_ dSrC) _data_elem_lastr_tailr_comment_factoryrr _pi_factoryrr_factory)r3element_factoryrrrrs r&r5zTreeBuilder.__init__sr      "%O /.  .J%$  "%O' r%c|jS)z;Flush builder buffers and return toplevel document Element.rr8s r&rzTreeBuilder.closes zr%c|jrJ|j:d|j}|jr ||j_n ||j_g|_dSdSNr)rrjoinrrErDr3rDs r&_flushzTreeBuilder._flushs\ : z%wwtz**:+&*DJOO'+DJODJJJ  r%c:|j|dS)zAdd text to current element.N)rr^r3rs r&rzTreeBuilder.datas $r%c||||x|_}|jr!|jd|n|j||_|j|d|_|S)zOpen new element and return it. *tag* is the element name, *attrs* is a dict containing element attributes. rcNr)rrrrr^rr)r3r(attrsrFs r&startzTreeBuilder.starts  MM#u555 T :  JrN ! !$ ' ' ' ' Z DJ $  r%c||j|_d|_|jS)zOClose and return current Element. *tag* is the element name. r)rrpoprrrs r&rzTreeBuilder.ends5 Z^^%%  zr%cD||j|j|S)z`Create a comment using the comment_factory. *text* is the text of the comment. )_handle_singlerrrs r&commentzTreeBuilder.comments) ""  !4#7?? ?r%cF||j|j||S)zCreate a processing instruction using the pi_factory. *target* is the target name of the processing instruction. *text* is the data of the processing instruction, or ''. )rrr)r3rrDs r&pizTreeBuilder.pis* ""  dovt== =r%c||}|rI|||_|jr |jd|d|_|S)Nrcr)rrrr^r)r3factoryreargsrFs r&rzTreeBuilder._handle_singlesYw~   KKMMMDJz , 2%%d+++DJ r%rC) r r!r"r#r5rrrrrrrrr$r%r&rrts&(!%$!&5((((((      "   ???====r%rcbeZdZdZddddZdZdZdZdZd Z d Z d Z d Z d Z dZdZdS)raaElement structure builder for XML source data based on the expat parser. *target* is an optional target object which defaults to an instance of the standard TreeBuilder class, *encoding* is an optional encoding string which if given, overrides the encoding specified in the XML file: http://www.iana.org/assignments/character-sets N)rrc@ ddlm}n3#t$r& ddl}n#t$rtdwxYwYnwxYw||d}|t }|x|_|_|x|_|_ |j |_ i|_ |j |_t|dr |j|_t|dr |j|_t|dr |j|_t|dr |j|_t|d r |j|_t|d r |j|_t|d r |j|_d |_d |_d|_ i|_! d |j"z|_#dS#tH$rYdSwxYw)Nrexpatz7No module named expat; use SimpleXMLTreeBuilder insteadrrrstart_nsend_nsrrrrzExpat %d.%d.%d)% xml.parsersr ImportErrorpyexpat ParserCreaterrrvr_targeterror_error_names_defaultDefaultHandlerExpandr)_startStartElementHandler_endEndElementHandler _start_nsStartNamespaceDeclHandler_end_nsEndNamespaceDeclHandlerrCharacterDataHandlerrCommentHandlerrProcessingInstructionHandler buffer_textordered_attributes_doctypeentity version_infoversionr)r3rrrrs r&r5zXMLParser.__init__s  ) ) ) ) ) ) )    '''''   !M (' ##Hc22 > ]]F%++ dl%++ dlk  &*m# 67 # # 5)-F & 65 ! ! 1'+yF $ 6: & & >/3~F , 68 $ $ :-1\F * 66 " " 6*0+F ' 69 % % 3$*NF ! 64  <28)F /$%!   +e.@@DLLL    DD s. 99399>F FFc|j}|j}|D]}|dkrd|_|||jfd}||_#|dkr|||jfd}||_=|dkr0t|jdr |||j fd}n||fd }||_ s|d kr0t|jd r |||j fd }n||fd }||_ |dkr|||fd}||_ |dkr|||fd}||_td|zdS)Nrrc4|||||fdSrCr$)r( attrib_inrr^rs r&handlerz%XMLParser._setevents..handler1s)FE55i#8#89:::::r%rc2||||fdSrCr$)r(rr^rs r&rz%XMLParser._setevents..handler6s%FE33s88,-----r%zstart-nsrc4|||||fdSrCr$)rrrr^rs r&rz%XMLParser._setevents..handler=s)xx'<'<=>>>>>r%c,|||pd|pdffdSrr$)rrrr^s r&rz%XMLParser._setevents..handlerAs* "ciR'@ABBBBBr%zend-nsrc2||||fdSrCr$)rrr^rs r&rz%XMLParser._setevents..handlerGs%vvf~~677777r%c ||dfdSrCr$)rrr^s r&rz%XMLParser._setevents..handlerKst}-----r%rcP|||j|fdSrC)rr)rDrr^r3s r&rz%XMLParser._setevents..handlerOs-FE4;#6#6t#<#<=>>>>>r%rcR|||j||fdSrC)rr) pi_targetrrr^r3s r&rz%XMLParser._setevents..handlerSs-FE4;>>)T#B#BCDDDDDr%zunknown event %r)rvr^rrrrrr)rrrrrrrr)r3 events_queueevents_to_reportrr^ event_namers r&rzXMLParser._setevents%s$** B* BJW$$,-)2fCCCC3:00x''4;11..8'+|88888/9....18..y(((26????(/%%t##3=f!%EEEE7>33 !3j!@AAAU* B* Br%cbt|}|j|_|j|jf|_|rC)r codelinenooffsetposition)r3rerrs r& _raiseerrorzXMLParser._raiseerrorZs-:|U\1  r%cn |j|}n%#t$r|}d|vrd|z}||j|<YnwxYw|S)Nrr)rKeyError)r3r}names r&_fixnamezXMLParser._fixname`s` $;s#DD $ $ $Dd{{Tz#DK     $  s 22c@|j|pd|pdSr)rrr3rrs r&rzXMLParser._start_nsks"{##FLb#)<<tdt|dD]}||dz||||< |j||S)NrrKr)rrangerHrr)r3r( attr_listfixnamer1is r&rzXMLParser._startqs-gcll  ?1c)nna00 ? ?09!A#wwy|,,--{  f---r%c\|j||SrC)rrrrs r&rzXMLParser._end}s"{t}}S11222r%c|dd}|dkr |jj}n#t$rYdSwxYw ||j|dddS#t$raddlm}|d||jj |jj fz}d|_ |jj |_ |jj |_ |wxYw|dkr|dd d kr g|_dS|j|d kr d|_dS|}|sdS|j|t#|j}|d kr|jd}|d kr|dkr|j\}}} } | r | dd} n|dkr|dkr|j\}}} d} ndSt%|jdr%|j|| | ddn*t%|drt)jdt,d|_dSdSdS)NrrErcrrz'undefined entity %s: line %d, column %d r z RuntimeWarning) r3rDr data_handlerrrnrhrpubidsystems r&rzXMLParser._defaults}bqb S== #{/ !      T[ad455555   ------kk=4;6K133 ![8 ![:   s]]tBQBx;66DMMM ] &}} $ ::< AAA A) B) A63B5A66B Bcp|j} |jd|jddn,#|j$r}||Yd}~nd}~wwxYw|j|dS#|j|wxYw)NFr%)rGetReparseDeferralEnabledSetReparseDeferralEnabledrrr)r3 was_enabledrs r&rzXMLParser.flushsk;;==  ? K 1 1% 8 8 8 K  c5 ) ) ) ){     Q          K 1 1+ > > > > >DK 1 1+ > > > >s/5AB A:A50B5A::BB5)r r!r"r#r5rrrrrrrrrrrr$r%r&rrs"&+++++Z3B3B3Bj   ===000 . . .3334%4%4%l   ***"?????r%r)out from_filec H||tdd}|tjx}}tt |jfi|}|*|||n|t|||| ndS)a3Convert XML to its C14N 2.0 serialised form. If *out* is provided, it must be a file or file-like object that receives the serialised canonical XML output (text, not bytes) through its ``.write()`` method. To write to a file, open it in text mode with encoding "utf-8". If *out* is not provided, this function returns the output as text string. Either *xml_data* (an XML string) or *from_file* (a file path or file-like object) must be provided as input. The configuration options are the same as for the ``C14NWriterTarget``. Nz:Either 'xml_data' or 'from_file' must be provided as inputr)r) rrrSrrrrrr rU)xml_datar!r"optionssiors r&rrsI-UVVV C {KMM!c .syDDGDD E E EF H    i'''' _3<<>>>$6r%z ^\w+:\w+$ceZdZdZdddddddddZefdZdZddZd Z d j fd Z d Z d Z ddZdZdZdZdS)ra Canonicalization writer target for the XMLParser. Serialises parse events to XML C14N 2.0. The *write* function is used for writing out the resulting data stream as text (not bytes). To write to a file, open it in text mode with encoding "utf-8" and pass its ``.write`` method. Configuration options: - *with_comments*: set to true to include comments - *strip_text*: set to true to strip whitespace before and after text content - *rewrite_prefixes*: set to true to replace namespace prefixes by "n{number}" - *qname_aware_tags*: a set of qname aware tag names in which prefixes should be replaced in text content - *qname_aware_attrs*: a set of qname aware attribute names in which prefixes should be replaced in text content - *exclude_attrs*: a set of attribute names that should not be serialised - *exclude_tags*: a set of tag names that should not be serialised FN) with_comments strip_textrewrite_prefixesqname_aware_tagsqname_aware_attrs exclude_attrs exclude_tagscX||_g|_||_||_|rt |nd|_|rt |nd|_||_|rt ||_nd|_|rt |j |_ nd|_ dgg|_ g|_ |s>|j tt|j gi|_dg|_d|_d|_d|_d|_dS)N)rArFr)_writer_with_comments _strip_textr_exclude_attrs _exclude_tags_rewrite_prefixes_qname_aware_tags intersection_find_qname_aware_attrs_declared_ns_stack _ns_stackr^rrr _prefix_map_preserve_space_pending_start _root_seen _root_done_ignored_depth) r3rr(r)r*r+r,r-r.s r&r5zC14NWriterTarget.__init__sE  +%4AKc-000t2>HS...D!1  *%()9%:%:D " "%)D "  0+./@+A+A+ND ( (+/D ( <$ #  @ N ! !$~';';'='=">"> ? ? ? b!!! %w"r%c#:K||D] }|r|Ed{V dSrCr$)r3ns_stack _reversedrps r&_iter_namespacesz!C14NWriterTarget._iter_namespaces7sJ#)H-- & &J &%%%%%%%% & &r%c|dd\}}||jD]\}}||kr d|d|cStd|d|d)NrrrrzPrefix z of QName "" is not declared in scope)splitrDr:r)r3 prefixed_namerrrps r&_resolve_prefix_namez%C14NWriterTarget._resolve_prefix_name<s$**322 ++DN;; * *FCF{{)C))4)))))_6__m___```r%c|4|dddkr|ddddnd|f\}}n|}t}||jD]4\}}||kr||vr|r|d|n|||fcS||5|jrd||jvr|j|}n!dt|jx}|j|<|jd||f|d|||fS|s d|vr|||fS||j D]=\}}||kr2|jd||f|r|d|n|||fcS>|s|||fStd|d ) Nrrrrrrrcz Namespace "rF) rrrDr9addr5r;rHr^r:r)r3rrr( prefixes_seenurs r&_qnamezC14NWriterTarget._qnameCs$ ;38!93C3CuQRRy''Q///"eHCC ..t/FGG & &IAvCxxF-77,2;&((3(((S#EEEE   f % % % %  ! /d&&&)#.1LS9I5J5J1L1LL)#.  #B ' . .V} = = =$$s$$c3. . !r..S= ..t~>> F FIAvCxx'+22C=AAA,2;&((3(((S#EEEE !S= FsFFFGGGr%cL|js|j|dSdSrC)r@rr^rs r&rzC14NWriterTarget.datahs3" $ J  d # # # # # $ $r%rcd||j}|jdd=|jr!|jds|}|j7|jdc}|_|rt |r|nd}|jg||R|dS|r+|jr&|t|dSdSdSNrc) rr2r<rjr=_looks_like_prefix_namerr>r0_escape_cdata_c14n)r3 _join_textrr qname_texts r&rzC14NWriterTarget._flushlsz$*%% JqqqM   D$8$< ::<D  F C/////r%cj"|r fd|D}|h|}i}|/|x}||<||jh|rf|}|rL|D]H} || } t | r/| x}|| <||Ind}nd}jfdt|dD} |r!d|D} | ng} |rlt|D]J\} }|| |vr||vr| ||d}| | \}} }| |r|n| |fK| d}j |r|dkn j d j }|d | |dz| r(|d d | D|d |*|t| ||dd_j gdS)Nc.i|]\}}|jv||Sr$)r3).0rrr3s r& z+C14NWriterTarget._start..s,TTTdaq@S7S7SQ7S7S7Sr%c(i|]}||Sr$r$)r\r parse_qnames r&r]z+C14NWriterTarget._start..s/444qKKNN444r%c.|ddS)Nrr)rG)rs r&rz)C14NWriterTarget._start..s!''#q//r%rc*g|]\}}|rd|znd|fS)zxmlns:xmlnsr$)r\rrs r& z+C14NWriterTarget._start..s@C'-9F""'3?r%rz+{http://www.w3.org/XML/1998/namespace}spacepreservercrrc@g|]\}}d|dt|dS)rrr)_escape_attrib_c14n)r\rrs r&rcz+C14NWriterTarget._start..s9TTT$!Q=q==$7$:$:===TTTr%rT)r3rrJrLr8rSrOrsortr^r|r<r0rrTr>r:)r3r(rrYrVrresolved_namesrqattrs attr_namer parsed_qnamesrrr attr_qnamerspace_behaviourrr_s` @r&rzC14NWriterTarget._starts6   *u *TTTTekkmmTTTE  !151J1J:1V1V VEN:. JJu     ' 3 311%88F !'**I!),E.u55*8<8Q8QRW8X8XXu 5 5))) * Fk 4444F 11535353444   #1I NN    I  Hu{{}}-- H H1%!v++!~:M:M%nQ&78;A-:1-=* Is  "B**A!FGGGG ))$QRR ##-< *Oz ) )%b) + + +   cM#&q))***  W E"''TT)TTTUU V V V c   ! E$]>*3M%Nq%QRR S S S b!!!!!r%c|jr|xjdzc_dS|jr||d||dd|jt|jdk|_|j |j dS)Nrrrr) r@rrr0rOr<rrHr?r9r:rs r&rzC14NWriterTarget.ends      1 $   F :  KKMMM /S))!,///000   """d233q8 ##%%% r%c0|jsdS|jrdS|jr|dn"|jr|jr||dt|d|js|ddSdS)Nrz)r1r@r?r0r>rrrTrs r&rzC14NWriterTarget.comments"  F    F ?  KK     _   KKMMM 8-d33888999  KK       r%c4|jrdS|jr|dn"|jr|jr|||rd|dt |dnd|d|js|ddSdS)Nrz)r@r?r0r>rrrT)r3rrs r&rzC14NWriterTarget.pis    F ?  KK     _   KKMMM :> S 6 6 6,T22 6 6 6 6OOOO U U U  KK       r%rC)r r!r"r#r5reversedrDrJrOrrrrrrrrrr$r%r&rrs, %"&$#$# # # # # J4<&&&& aaa#H#H#H#HJ$$$!# 2 2 2 2111000"C"C"C"C"J           r%rc& d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw) NrErFrrGrrHrN rIrs r&rTrTs) $;;<<W--D $;;<<V,,D $;;<<V,,D 4<<<<g..D ~ &)))"4(((((()sA)A,, BBc d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}d |vr|d d }d |vr|d d }|S#ttf$rt|YdSwxYw) NrErFrrGrrMrOz rz rNrsrIrs r&rfrfs) $;;<<W--D $;;<<V,,D $;;<<X..D 4<<<<g..D 4<<<<g..D 4<<<<g..D ~ &)))"4(((((()sBB CC)r)_set_factoriesrCr)rfr)@r#__all__rrdr:r=rrcollections.abcrrrrrr r rrrrr rrcontextmanagerrrrr4r2rrrrrrrr3rrrXrrrr r rrrrrrrrcompileUNICODEr;rSrrTrfrg _elementtreerurr$r%r&r|s'!!P   (             ### jjjjjjjjZ $&$     +"+"+"+"+"+"+"+"`_/_/_/_/_/_/_/_/H /+/+/+b;;;;z0(0(0(d 0(0(0(d    !!!*-2$*38(.(,16(,  %3!   ))) )))8 ) ) )!T"&0b'" !%&*     &////l    5555p77777777t",     $vvvvvvvvth?h?h?h?h?h?h?h?Z7tt77777<%"*\2:>>DD)))&))). 3K++++++N7122222   DD s E77F?FPKN\CfY4etree/__pycache__/cElementTree.cpython-311.opt-1.pycnu[ !A?hRddlTdS))*N)xml.etree.ElementTreeC/opt/alt/python-internal/lib64/python3.11/xml/etree/cElementTree.pyrs$#####rPKN\CfY4etree/__pycache__/cElementTree.cpython-311.opt-2.pycnu[ !A?hRddlTdS))*N)xml.etree.ElementTreeC/opt/alt/python-internal/lib64/python3.11/xml/etree/cElementTree.pyrs$#####rPKN\^Tkaa-etree/__pycache__/ElementTree.cpython-311.pycnu[ !A?h"dZgdZdZddlZddlZddlZddlZddlZddlZddl Z ddl Z ddl m Z Gdde Zd ZGd d Zifd ZdDd ZdDdZeZGddZGddZe jdZdDdZdZhdZdZdZeeedZdZdddddd d!d"Z e e_ d#Z!d$Z"d%Z#d&Z$dEddd'd(d)Z%Gd*d+ej&Z'dEddd'd(d,Z(d-Z)dFd/Z*dDd0Z+dEd1Z,Gd2d3Z-dDd4Z.dDd5Z/e.Z0dDd6Z1Gd7d8Z2Gd9d:Z3dDddd;d<Z4ej5d=ej6j7Z8Gd>d?Z9d@Z:dAZ; eZZ>e>eedS#e?$rYdSwxYw)GaLightweight XML support for Python. XML is an inherently hierarchical data format, and the most natural way to represent it is with a tree. This module has two classes for this purpose: 1. ElementTree represents the whole XML document as a tree and 2. Element represents a single node in this tree. Interactions with the whole document (reading and writing to/from files) are usually done on the ElementTree level. Interactions with a single XML element and its sub-elements are done on the Element level. Element is a flexible container object designed to store hierarchical data structures in memory. It can be described as a cross between a list and a dictionary. Each Element has a number of properties associated with it: 'tag' - a string containing the element's name. 'attributes' - a Python dictionary storing the element's attributes. 'text' - a string containing the element's text content. 'tail' - an optional string containing text after the element's end tag. And a number of child elements stored in a Python sequence. To create an element instance, use the Element constructor, or the SubElement factory function. You can also use the ElementTree class to wrap an element structure and convert it to and from XML. )CommentdumpElement ElementTree fromstringfromstringlistindent iselement iterparseparse ParseErrorPIProcessingInstructionQName SubElementtostring tostringlist TreeBuilderVERSIONXMLXMLID XMLParser XMLPullParserregister_namespace canonicalizeC14NWriterTargetz1.3.0N) ElementPathceZdZdZdS)r zAn error when parsing an XML document. In addition to its exception value, a ParseError contains two extra attributes: 'code' - the specific exception code 'position' - the line and column of the error N)__name__ __module__ __qualname____doc__B/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementTree.pyr r ks Dr%r c"t|dS)z2Return True if *element* appears to be an Element.tag)hasattr)elements r&r r ys 7E " ""r%ceZdZdZdZ dZ dZ dZ ifdZdZ dZ dZ dZ dZ d Zd Zd Zd Zd ZdZdZdZdZddZddZddZddZdZddZdZdZdZddZ dZ!dS)rahAn XML element. This class is the reference implementation of the Element interface. An element's length is its number of subelements. That means if you want to check if an element is truly empty, you should check BOTH its length AND its text attribute. The element tag, attribute names, and attribute values can be either bytes or strings. *tag* is the element name. *attrib* is an optional dictionary containing element attributes. *extra* are additional element attributes given as keyword arguments. Example form: text...tail Nc t|tstd|jj||_i|||_g|_dS)Nzattrib must be dict, not ) isinstancedict TypeError __class__r r(attrib _children)selfr(r1extras r&__init__zElement.__init__s\&$'' -) )),-- -))5) r%cJd|jj|jt|fzS)Nz<%s %r at %#x>)r0r r(idr3s r&__repr__zElement.__repr__s!4>#:DHbhh"OOOr%c.|||S)zCreate a new element with the same type. *tag* is a string containing the element name. *attrib* is a dictionary containing the element attributes. Do not call this method, use the SubElement factory function instead. )r0)r3r(r1s r& makeelementzElement.makeelements~~c6***r%c^tjdt|S)zReturn copy of current element. This creates a shallow copy. Subelements will be shared with the original tree. z7elem.copy() is deprecated. Use copy.copy(elem) instead.)warningswarnDeprecationWarning__copy__r8s r&copyz Element.copys.  E    }}r%c||j|j}|j|_|j|_||dd<|SN)r;r(r1texttail)r3elems r&r@zElement.__copy__s?$+66I I QQQ r%c*t|jSrC)lenr2r8s r&__len__zElement.__len__s4>"""r%cjtjdtdt|jdkS)NzyThe behavior of this method will change in future versions. Use specific 'len(elem)' or 'elem is not None' test instead. stacklevelr)r=r> FutureWarningrHr2r8s r&__bool__zElement.__bool__s=  K a     4>""a''r%c|j|SrCr2r3indexs r& __getitem__zElement.__getitem__s~e$$r%ct|tr|D]}||n||||j|<dSrC)r-slice_assert_is_elementr2)r3rSr*elts r& __setitem__zElement.__setitem__sg eU # # - - -'',,,, -  # #G , , , 'ur%c|j|=dSrCrQrRs r& __delitem__zElement.__delitem__s N5 ! ! !r%cd|||j|dS)aAdd *subelement* to the end of this element. The new element will appear in document order after the last existing subelement (or directly after the text, if it's the first subelement), but before the end tag for this element. NrWr2appendr3 subelements r&r^zElement.appends4  +++ j)))))r%cn|D]1}|||j|2dS)zkAppend subelements from a sequence. *elements* is a sequence with zero or more elements. Nr])r3elementsr*s r&extendzElement.extendsJ   + +G  # #G , , , N ! !' * * * * + +r%cf|||j||dS)z(Insert *subelement* at position *index*.N)rWr2insert)r3rSr`s r&rezElement.inserts4  +++ eZ00000r%cxt|ts$tdt|jzdS)Nzexpected an Element, not %s)r- _Element_Pyr/typer )r3es r&rWzElement._assert_is_elements@![)) N9DGG)r0r rDr8s r&r9zQName.__repr__s  N333TYYY??r%c*t|jSrC)hashrDr8s r&__hash__zQName.__hash__sDIr%cbt|tr|j|jkS|j|kSrCr-rrDr3others r&__le__z QName.__le__0 eU # # +9 * *yE!!r%cbt|tr|j|jkS|j|kSrCrrs r&__lt__z QName.__lt__0 eU # # *9uz) )y5  r%cbt|tr|j|jkS|j|kSrCrrs r&__ge__z QName.__ge__rr%cbt|tr|j|jkS|j|kSrCrrs r&__gt__z QName.__gt__rr%cbt|tr|j|jkS|j|kSrCrrs r&__eq__z QName.__eq__rr%rC) r r!r"r#r5rr9rrrrrrr$r%r&rrs      @@@"""!!!"""!!!"""""r%rcreZdZdZddZdZdZddZddZddZ dd Z dd Z dd Z dd d dZ dZdS)ra%An XML element hierarchy. This class also provides support for serialization to and from standard XML. *element* is an optional root element node, *file* is an optional file handle or file name of an XML file whose contents will be used to initialize the tree with. NcF||_|r||dSdSrC)_rootr )r3r*files r&r5zElementTree.__init__s3   JJt       r%c|jS)z!Return root element of this tree.rr8s r&getrootzElementTree.getroots zr%c||_dS)zReplace root element of this tree. This will discard the current contents of the tree and replace it with the given element. Use with care! Nr)r3r*s r&_setrootzElementTree._setroot#s r%cd}t|dst|d}d} |Vt}t|dr8|||_|j|r|SS |d}|sn||.||_|j|r|SS#|r|wwxYw)a=Load external XML document into element tree. *source* is a file name or file object, *parser* is an optional parser instance that defaults to XMLParser. ParseError is raised if the parser fails to parse the document. Returns the root element of the given source document. FreadrbTN _parse_wholei)r)openrrrcloserfeed)r3sourceparser close_sourcedatas r&r zElementTree.parse-s vv&& &$''FL ~"6>22& "(!4!4V!AC$$C=c6|j|S)zCreate and return tree iterator for the root element. The iterator loops over all elements in this tree, in document order. *tag* is a string with the tag name to iterate over (default is to return all elements). )rrr3r(s r&rzElementTree.iterRszs###r%c|dddkr$d|z}tjd|ztd|j||S)a\Find first matching element by tag name or path. Same as getroot().find(path), which is Element.find() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. Nr/.This search is broken in 1.3 and earlier, and will be fixed in a future version. If you rely on the current behaviour, change it to %rrKrL)r=r>rNrrmrns r&rmzElementTree.find^sc 8s??:D M-/34!      ztZ000r%c|dddkr$d|z}tjd|ztd|j|||S)aeFind first matching element by tag name or path. Same as getroot().findtext(path), which is Element.findtext() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. NrrrrrKrL)r=r>rNrrrrss r&rrzElementTree.findtexttsg 8s??:D M-/34!      z""4*===r%c|dddkr$d|z}tjd|ztd|j||S)aaFind all matching subelements by tag name or path. Same as getroot().findall(path), which is Element.findall(). *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return list containing all matching elements in document order. NrrrrrKrL)r=r>rNrrvrns r&rvzElementTree.findallse 8s??:D M-/34!      z!!$ 333r%c|dddkr$d|z}tjd|ztd|j||S)agFind all matching subelements by tag name or path. Same as getroot().iterfind(path), which is element.iterfind() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return an iterable yielding all matching elements in document order. NrrrrrKrL)r=r>rNrrxrns r&rxzElementTree.iterfindse 8s??:D M-/34!      z""4444r%Tshort_empty_elementsc|sd}n|tvrtd|z|s |dkrd}nd}t||5\}}|dkrA|s0|=|dkr%|dvr|d |d |d krt ||jn:t |j|\} } t|} | ||j| | | ddddS#1swxYwYdS) aWrite element tree to a file as XML. Arguments: *file_or_filename* -- file name or a file object opened for writing *encoding* -- the output encoding (default: US-ASCII) *xml_declaration* -- bool indicating if an XML declaration should be added to the output. If None, an XML declaration is added if encoding IS NOT either of: US-ASCII, UTF-8, or Unicode *default_namespace* -- sets the default XML namespace (for "xmlns") *method* -- either "xml" (default), "html, "text", or "c14n" *short_empty_elements* -- controls the formatting of elements that contain no content. If True (default) they are emitted as a single self-closed tag, otherwise they are emitted as a pair of start/end tags xmlzunknown method %rc14nutf-8us-asciiNunicode)rrz rDr) _serialize ValueError _get_writerlower_serialize_textr _namespaces) r3file_or_filenameencodingxml_declarationdefault_namespacemethodrwritedeclared_encodingqnamesrp serializes r&rzElementTree.writes: ;FF : % %069:: : &"% )8 4 4 E8R@QO$,^^%%22&,,..6KKK%%%()))tz2222%0=N%O%O" &v.  %VZ/CEEEE E E E E E E E E E E E E E E E E E EsB!C,,C03C0c0||dS)Nr)r)r)r3rs r& write_c14nzElementTree.write_c14nszz$vz...r%rrC)NNNN)r r!r"r#r5rrr rrmrrrvrxrrr$r%r&rrs   ####J $ $ $ $1111,>>>>,4444,5555." $ 3E $( 3E3E3E3E3Ej/////r%rc#xK |j}|dkr|t|ddpdfVdStj5}t |t jr|}nt |t jr/t j |}| |j nLt j}d|_ ||_ |j |_ |j|_n#t$rYnwxYwt j||dd}| |j |j|fVddddS#1swxYwYdS#t$rV|dkrd}t#|d|d 5}|j|fVdddYdS#1swxYwYYdSwxYw) NrrrcdSNTr$r$r%r&z_get_writer..sDr%xmlcharrefreplace )rerrorsnewlinew)rr)rrgetattr contextlib ExitStackr-ioBufferedIOBase RawIOBaseBufferedWritercallbackdetachwritableseekabletellAttributeError TextIOWrapperr)rrrstackrs r&rrs-+ & >>  y ( (!1:tDDOO O O O O O%'' +5.0ABB+DD 0",??,-=>>DNN4;////,..D$0LDM!&DJ)9(A $4$9 )'19/B04666 t{+++j(****9 + + + + + + + + + + + + + + + + + + ''' >>  y ( (H "C(,... '15*h& & & & ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' 'smEB E C21E 2 C?<E >C??AE  EE7F9 F* F9*F. .F91F. 2F98F9cddiird<fd}|D])}|j}t|tr|jvr||jnHt|t r|vr ||n#|!|t ur|turt|| D]^\}}t|tr|j}|vr ||t|tr|jvr||j_|j}t|tr|jvr||j+fS)Nc |dddkr|dddd\}}|}|9t|}|dtz}|dkr||<|r |d||<dS||<dSrt d||<dS#t $rt |YdSwxYw)Nrrrzns%dr:z.add_qname/s .RaRyC 9++C33S#,,>+//44F~!'#j//!9*0 3(/5vvss$;F5MMM$'F5MMM$$3!&u  . . . &u - - - - - - .sB B/B/B//C  C ) rr(r-rrDrrr rr) rFrrr(r}rrDrprs ` @@r&rr$sD\FJ+(* $%.......8 !!h c5 ! ! ,xv%% #(### S ! ! ,&   # _G!3!32 &s + + +**,, & &JC#u%% h&   #%'' &EJf,D,D %*%%%y dE " " !ty'>'> Idi : r%c |j}|j}|tur|d|zn|tur|d|zn||}|5|r|t ||D]}t |||d|na|d|zt |} | s|r|rPt|dD]+\} } | rd| z} |d| d t| d ,| D]k\} } t| tr| j} t| tr|| j} nt| } |d || d | d l|st|s|sP|d |r|t ||D]}t |||d||d |zd zn |d|j r|t |j dSdS)N rrc|dSNrr$xs r&rz _serialize_xml..w QqTr%r}r xmlns=""rr)r(rDrr _escape_cdata_serialize_xmllistrsorted_escape_attribr-rrHrE) rrFrrprkwargsr(rDrirvks r&rras (C 9D g~~ kD !!!! % % % hoSk ; +mD))*** J Jua4HJJJJJ J E#)   &&E 9  9 &z'7'7'9'9+9>!;!;!;1( #aAAA*1----"99DAq!!U++#F!!U++."16N*1--EE&)))QQQ78888 s4yy (< c /E---...NNA"5!VT8LNNNNNdSj3&''''e  y( mDI&&'''''((r%>brhrcolimgwbrareabaselinkmetaembedframeinputparamtrackrisindexbasefontc j|j}|j}|tur|dt|zn|tur|dt|zn||}|3|r|t||D]}t |||dnu|d|zt |}|s|r|rPt|dD]+\} } | rd| z} |d| dt| d ,|D]k\} } t| tr| j} t| tr|| j} nt| } |d || d| d l|d | } |r0| d ks| d kr ||n|t||D]}t |||d| tvr|d|zd z|jr|t|jdSdS)Nr r rc|dSr r$rs r&rz!_serialize_html..rr%rrrrrrrscriptstyler)r(rDrrr_serialize_htmlrrrrr-r_escape_attrib_htmlr HTML_EMPTYrE) rrFrrprr(rDrirrrltags r&r2r2s (C 9D g~~ kM$///0000 % % % ht,,,----Sk ; +mD))*** 8 8q&$7777 8 E#)   &&E 9  9 &z'7'7'9'9+9>!;!;!;1( #aAAA*1----"99DAq!!U++#F!!U++3"16N/22EE&)))QQQ78888 E#JJJ99;;D /8##twE$KKKKE---... 8 8q&$7777:%%dSj3&''' y( mDI&&'''''((r%c||D] }|||jr||jdSdSrC)rrE)rrFparts r&rrsT  d  y dir%)rhtmlrDctjd|rtdttD]\}}||ks||krt|=|t|<dS)atRegister a namespace prefix. The registry is global, and any existing mapping for either the given prefix or the namespace URI will be removed. *prefix* is the namespace prefix, *uri* is a namespace uri. Tags and attributes in this namespace will be serialized with prefix if possible. ValueError is raised if prefix is reserved or is invalid. zns\d+$z'Prefix format reserved for internal useN)rematchrrrr)rrrrs r&rrsy x 6""DBCCC^))++,,""1 88qF{{q! N3r%rr8rdfwsdlxsxsidc)$http://www.w3.org/XML/1998/namespacezhttp://www.w3.org/1999/xhtmlz+http://www.w3.org/1999/02/22-rdf-syntax-ns#z http://schemas.xmlsoap.org/wsdl/z http://www.w3.org/2001/XMLSchemaz)http://www.w3.org/2001/XMLSchema-instancez http://purl.org/dc/elements/1.1/cRtd|dt|jd)Nzcannot serialize z (type ))r/rhr rs r&rrs1 )+/44d1D1D1DE   r%c d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw)N&&r<r>replacer/rrrs r&rrs ) $;;<<W--D $;;<<V,,D $;;<<V,,D ~ &)))"4(((((()AA A65A6c d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}d |vr|d d }d |vr|d d }d |vr|d d}|S#ttf$rt|YdSwxYw)NrErFrrGrrHr" z rz  z rIrs r&rrs ) $;;<<W--D $;;<<V,,D $;;<<V,,D 4<<<<h//D 4<<<<g..D 4<<<<g..D 4<<<<g..D ~ &)))"4(((((()sB7B:: CCc d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw)NrErFrrHrrMrIrs r&r3r3+s ) $;;<<W--D $;;<<V,,D 4<<<<h//D ~ &)))"4(((((()rKT)rrrc|dkrtjntj}t||||||||S)a Generate string representation of XML element. All subelements are included. If encoding is "unicode", a string is returned. Otherwise a bytestring is returned. *element* is an Element instance, *encoding* is an optional output encoding defaulting to US-ASCII, *method* is an optional output which can be one of "xml" (default), "html", "text" or "c14n", *default_namespace* sets the default XML namespace (for "xmlns"). Returns an (optionally) encoded string containing the XML data. rrrrr)rStringIOBytesIOrrgetvalue)r*rrrrrstreams r&rr:sm ')33R[]]]Fvx/>1B&,4H JJJ ??  r%c0eZdZdZdZdZdZdZdZdS)_ListDataStreamz7An auxiliary stream accumulating into a list reference.c||_dSrC)lst)r3rZs r&r5z_ListDataStream.__init__Ts r%cdSrr$r8s r&rz_ListDataStream.writableWtr%cdSrr$r8s r&rz_ListDataStream.seekableZr\r%c:|j|dSrC)rZr^)r3bs r&rz_ListDataStream.write]s r%c*t|jSrC)rHrZr8s r&rz_ListDataStream.tell`s48}}r%N) r r!r"r#r5rrrrr$r%r&rXrXRseAAr%rXcxg}t|}t||||||||S)NrR)rXrr)r*rrrrrrZrVs r&rrcsU C S ! !Fvx/>1B&,4H JJJ Jr%c t|tst|}|tjd|j}|r |ddkr!tjddSdS)a#Write element tree or element structure to sys.stdout. This function should be used for debugging only. *elem* is either an ElementTree, or a single Element. The exact output format is implementation dependent. In this version, it's written as an ordinary XML file. r)rrN)r-rrsysstdoutrrE)rFrEs r&rrps dK ( (!4  JJszIJ... <<>> D 48t## $#r% ct|tr|}|dkrtd|t |sdSd|zzgfd|ddS)a&Indent an XML document by inserting newlines and indentation space after elements. *tree* is the ElementTree or Element to modify. The (root) element itself will not be changed, but the tail text of all elements in its subtree will be adapted. *space* is the whitespace to insert for each indentation level, two space characters by default. *level* is the initial indentation level. Setting this to a higher value than 0 can be used for indenting subtrees that are more deeply nested inside of a document. rz,Initial indentation level must be >= 0, got Nrc|dz} |}n0#t$r#|z}|YnwxYw|jr|js||_|D]D}t |r |||jr|js||_E|js||_dSdSr ) IndexErrorr^rDstriprHrE)rFlevel child_levelchild_indentationchild_indent_children indentationsspaces r&roz indent.._indent_childrensai  3 ,[ 9   3 3 3 ,U 3e ;     1 2 2 2 2 2 3y *  1 1 *)DI / /E5zz 5   444: /UZ%5%5%7%7 /. z!! -%e,EJJJ - -s *>>)r-rrrrH)treerqrkrorps ` @@r&rrs$ $$||~~ qyyOOOPPP t9955=()L-------,T1r%cNt}||||S)zParse XML document into element tree. *source* is a filename or file object containing XML data, *parser* is an optional parser instance defaulting to XMLParser. Return an ElementTree instance. )rr )rrrrs r&r r s& ==DJJvv Kr%ct||tdstddndfdGfddtjj}|}d |_tj||S) aJIncrementally parse XML document into ElementTree. This class also reports what's going on to the user based on the *events* it is initialized with. The supported events are the strings "start", "end", "start-ns" and "end-ns" (the "ns" events are used to get detailed namespace information). If *events* is omitted, only "end" events are reported. *source* is a filename or file object containing XML data, *events* is a list of events to report back, *parser* is an optional parser instance. Returns an iterator providing (event, elem) pairs. )events_parserrrTFc3K Ed{V|d}|sn|H}Ed{V}|||_r|dSdS#r|wwxYw)NTi@) read_eventsrr_close_and_return_rootrootr)rrrzitr pullparserwrs r&iteratorziterparse..iterators  &%11333333333{{9--%%%  &4466D!--// / / / / / / /B~    |   s B B))Cc<eZdZjZfdZdS)$iterparse..IterParseIteratorc8rdSdSrC)r)r3rrs r&__del__z,iterparse..IterParseIterator.__del__s&    r%N)r r!r"__next__r)rr~rsr&IterParseIteratorrsE8F##,        r%rN) rr)r collectionsabcIteratorrzweakrefref) rrurrr{rr~r|r}s ` @@@@r&r r s"ff===J 66 " "fd##  $KO4    BBG RB Ir%c:eZdZd dddZdZdZdZdZdZdS) rN)rvctj|_|ptt |_|d}|j|j|dS)Nr)end)rdeque _events_queuerrrv _setevents)r3rurvs r&r5zXMLPullParser.__init__s[ ).00A);=="A"A"A >F  2F;;;;;r%c|jtd|rO |j|dS#t$r%}|j|Yd}~dSd}~wwxYwdS)Feed encoded data to parser.Nz!feed() called after end of stream)rvrr SyntaxErrorrr^)r3rexcs r&rzXMLPullParser.feed s < @AA A  / / !!$''''' / / /"))#......... / / /s6 A%A  A%cF|j}d|_|SrC)rvr)r3rzs r&ryz$XMLPullParser._close_and_return_roots!|!!##  r%c.|dS)zFinish feeding data to parser. Unlike XMLParser, does not return the root element. Use read_events() to consume elements from XMLPullParser. N)ryr8s r&rzXMLPullParser.closes ##%%%%%r%c#K|j}|r3|}t|tr||V|1dSdS)zReturn an iterator over currently available (event, elem) pairs. Events are consumed from the internal event queue as they are retrieved from the iterator. N)rpopleftr- Exception)r3ruevents r&rxzXMLPullParser.read_events%se # NN$$E%++        r%cd|jtd|jdS)Nz"flush() called after end of stream)rvrflushr8s r&rzXMLPullParser.flush3s3 < ABB B r%rC) r r!r"r5rryrrxrr$r%r&rrs >r%c|stt}|||}i}|D]}|d}|r|||<||fS)aParse XML document from string constant for its IDs. *text* is a string containing XML data, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an (Element, dict) tuple, in which the dict maps element id:s to elements. rr7)rrrrrr|)rDrrridsrFr7s r&rrJs 1+--000 KK <<>>D C  XXd^^  CG 9r%c|stt}|D]}|||S)zParse XML document from sequence of string fragments. *sequence* is a list of other sequence, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an Element instance. rr)sequencerrDs r&rrbsR 1+--000 D <<>>r%cXeZdZdZdddddddZdZdZdZd Zd Z d Z dd Z d Z dS)ra8Generic element structure builder. This builder converts a sequence of start, data, and end method calls to a well-formed element structure. You can use this class to build an element structure using a custom XML parser, or a parser for some other XML-like format. *element_factory* is an optional element factory which is called to create new Element instances, as necessary. *comment_factory* is a factory to create comments to be used instead of the standard factory. If *insert_comments* is false (the default), comments will not be inserted into the tree. *pi_factory* is a factory to create processing instructions to be used instead of the standard factory. If *insert_pis* is false (the default), processing instructions will not be inserted into the tree. NF)comment_factory pi_factoryinsert_comments insert_piscg|_g|_d|_d|_d|_|t }||_||_|t}||_ ||_ |t}||_ dSrC) _data_elem_lastr_tailr_comment_factoryrr _pi_factoryrr_factory)r3element_factoryrrrrs r&r5zTreeBuilder.__init__sr      "%O /.  .J%$  "%O' r%cvt|jdks Jd|j Jd|jS)z;Flush builder buffers and return toplevel document Element.rzmissing end tagsNzmissing toplevel element)rHrrr8s r&rzTreeBuilder.closesC4:!###%7###z%%'A%%%zr%c|jrv|jfd|j}|jr#|jj Jd||j_n"|jj Jd||j_g|_dSdS)Nrzinternal error (tail)zinternal error (text))rrjoinrrErDr3rDs r&_flushzTreeBuilder._flushs : z%wwtz**:+:?224K222&*DJOO:?224K222&*DJODJJJ  r%c:|j|dS)zAdd text to current element.N)rr^r3rs r&rzTreeBuilder.datas $r%c||||x|_}|jr!|jd|n|j||_|j|d|_|S)zOpen new element and return it. *tag* is the element name, *attrs* is a dict containing element attributes. rcNr)rrrrr^rr)r3r(attrsrFs r&startzTreeBuilder.starts  MM#u555 T :  JrN ! !$ ' ' ' ' Z DJ $  r%c||j|_|jj|ksJd|jjd|dd|_|jS)zOClose and return current Element. *tag* is the element name. zend tag mismatch (expected z, got rCr)rrpoprr(rrs r&rzTreeBuilder.endsk Z^^%% z~$$$$:>>>333(%$$ zr%cD||j|j|S)z`Create a comment using the comment_factory. *text* is the text of the comment. )_handle_singlerrrs r&commentzTreeBuilder.comments) ""  !4#7?? ?r%cF||j|j||S)zCreate a processing instruction using the pi_factory. *target* is the target name of the processing instruction. *text* is the data of the processing instruction, or ''. )rrr)r3rrDs r&pizTreeBuilder.pis* ""  dovt== =r%c||}|rI|||_|jr |jd|d|_|S)Nrcr)rrrr^r)r3factoryreargsrFs r&rzTreeBuilder._handle_singlesYw~   KKMMMDJz , 2%%d+++DJ r%rC) r r!r"r#r5rrrrrrrrr$r%r&rrts&(!%$!&5((((((      "   ???====r%rcbeZdZdZddddZdZdZdZdZd Z d Z d Z d Z d Z dZdZdS)raaElement structure builder for XML source data based on the expat parser. *target* is an optional target object which defaults to an instance of the standard TreeBuilder class, *encoding* is an optional encoding string which if given, overrides the encoding specified in the XML file: http://www.iana.org/assignments/character-sets N)rrc@ ddlm}n3#t$r& ddl}n#t$rtdwxYwYnwxYw||d}|t }|x|_|_|x|_|_ |j |_ i|_ |j |_t|dr |j|_t|dr |j|_t|dr |j|_t|dr |j|_t|d r |j|_t|d r |j|_t|d r |j|_d |_d |_d|_ i|_! d |j"z|_#dS#tH$rYdSwxYw)Nrexpatz7No module named expat; use SimpleXMLTreeBuilder insteadrrrstart_nsend_nsrrrrzExpat %d.%d.%d)% xml.parsersr ImportErrorpyexpat ParserCreaterrrvr_targeterror_error_names_defaultDefaultHandlerExpandr)_startStartElementHandler_endEndElementHandler _start_nsStartNamespaceDeclHandler_end_nsEndNamespaceDeclHandlerrCharacterDataHandlerrCommentHandlerrProcessingInstructionHandler buffer_textordered_attributes_doctypeentity version_infoversionr)r3rrrrs r&r5zXMLParser.__init__s  ) ) ) ) ) ) )    '''''   !M (' ##Hc22 > ]]F%++ dl%++ dlk  &*m# 67 # # 5)-F & 65 ! ! 1'+yF $ 6: & & >/3~F , 68 $ $ :-1\F * 66 " " 6*0+F ' 69 % % 3$*NF ! 64  <28)F /$%!   +e.@@DLLL    DD s. 99399>F FFc|j}|j}|D]}|dkrd|_|||jfd}||_#|dkr|||jfd}||_=|dkr0t|jdr |||j fd}n||fd }||_ s|d kr0t|jd r |||j fd }n||fd }||_ |dkr|||fd}||_ |dkr|||fd}||_td|zdS)Nrrc4|||||fdSrCr$)r( attrib_inrr^rs r&handlerz%XMLParser._setevents..handler1s)FE55i#8#89:::::r%rc2||||fdSrCr$)r(rr^rs r&rz%XMLParser._setevents..handler6s%FE33s88,-----r%zstart-nsrc4|||||fdSrCr$)rrrr^rs r&rz%XMLParser._setevents..handler=s)xx'<'<=>>>>>r%c,|||pd|pdffdSNrr$)rrrr^s r&rz%XMLParser._setevents..handlerAs* "ciR'@ABBBBBr%zend-nsrc2||||fdSrCr$)rrr^rs r&rz%XMLParser._setevents..handlerGs%vvf~~677777r%c ||dfdSrCr$)rrr^s r&rz%XMLParser._setevents..handlerKst}-----r%rcP|||j|fdSrC)rr)rDrr^r3s r&rz%XMLParser._setevents..handlerOs-FE4;#6#6t#<#<=>>>>>r%rcR|||j||fdSrC)rr) pi_targetrrr^r3s r&rz%XMLParser._setevents..handlerSs-FE4;>>)T#B#BCDDDDDr%zunknown event %r)rvr^rrrrrr)rrrrrrrr)r3 events_queueevents_to_reportrr^ event_namers r&rzXMLParser._setevents%s$** B* BJW$$,-)2fCCCC3:00x''4;11..8'+|88888/9....18..y(((26????(/%%t##3=f!%EEEE7>33 !3j!@AAAU* B* Br%cbt|}|j|_|j|jf|_|rC)r codelinenooffsetposition)r3rerrs r& _raiseerrorzXMLParser._raiseerrorZs-:|U\1  r%cn |j|}n%#t$r|}d|vrd|z}||j|<YnwxYw|S)Nrr)rKeyError)r3r}names r&_fixnamezXMLParser._fixname`s` $;s#DD $ $ $Dd{{Tz#DK     $  s 22c@|j|pd|pdSr)rrr3rrs r&rzXMLParser._start_nsks"{##FLb#)<<tdt|dD]}||dz||||< |j||S)NrrKr)rrangerHrr)r3r( attr_listfixnamer1is r&rzXMLParser._startqs-gcll  ?1c)nna00 ? ?09!A#wwy|,,--{  f---r%c\|j||SrC)rrrrs r&rzXMLParser._end}s"{t}}S11222r%c|dd}|dkr |jj}n#t$rYdSwxYw ||j|dddS#t$raddlm}|d||jj |jj fz}d|_ |jj |_ |jj |_ |wxYw|dkr|dd d kr g|_dS|j|d kr d|_dS|}|sdS|j|t#|j}|d kr|jd}|d kr|dkr|j\}}} } | r | dd} n|dkr|dkr|j\}}} d} ndSt%|jdr%|j|| | ddn*t%|drt)jdt,d|_dSdSdS)NrrErcrrz'undefined entity %s: line %d, column %d r z RuntimeWarning) r3rDr data_handlerrrnrhrpubidsystems r&rzXMLParser._defaults}bqb S== #{/ !      T[ad455555   ------kk=4;6K133 ![8 ![:   s]]tBQBx;66DMMM ] &}} $ ::< AAA A) B) A63B5A66B Bcp|j} |jd|jddn,#|j$r}||Yd}~nd}~wwxYw|j|dS#|j|wxYw)NFr%)rGetReparseDeferralEnabledSetReparseDeferralEnabledrrr)r3 was_enabledrs r&rzXMLParser.flushsk;;==  ? K 1 1% 8 8 8 K  c5 ) ) ) ){     Q          K 1 1+ > > > > >DK 1 1+ > > > >s/5AB A:A50B5A::BB5)r r!r"r#r5rrrrrrrrrrrr$r%r&rrs"&+++++Z3B3B3Bj   ===000 . . .3334%4%4%l   ***"?????r%r)out from_filec H||tdd}|tjx}}tt |jfi|}|*|||n|t|||| ndS)a3Convert XML to its C14N 2.0 serialised form. If *out* is provided, it must be a file or file-like object that receives the serialised canonical XML output (text, not bytes) through its ``.write()`` method. To write to a file, open it in text mode with encoding "utf-8". If *out* is not provided, this function returns the output as text string. Either *xml_data* (an XML string) or *from_file* (a file path or file-like object) must be provided as input. The configuration options are the same as for the ``C14NWriterTarget``. Nz:Either 'xml_data' or 'from_file' must be provided as inputr)r) rrrSrrrrrr rU)xml_datar!r"optionssiors r&rrsI-UVVV C {KMM!c .syDDGDD E E EF H    i'''' _3<<>>>$6r%z ^\w+:\w+$ceZdZdZdddddddddZefdZdZddZd Z d j fd Z d Z d Z ddZdZdZdZdS)ra Canonicalization writer target for the XMLParser. Serialises parse events to XML C14N 2.0. The *write* function is used for writing out the resulting data stream as text (not bytes). To write to a file, open it in text mode with encoding "utf-8" and pass its ``.write`` method. Configuration options: - *with_comments*: set to true to include comments - *strip_text*: set to true to strip whitespace before and after text content - *rewrite_prefixes*: set to true to replace namespace prefixes by "n{number}" - *qname_aware_tags*: a set of qname aware tag names in which prefixes should be replaced in text content - *qname_aware_attrs*: a set of qname aware attribute names in which prefixes should be replaced in text content - *exclude_attrs*: a set of attribute names that should not be serialised - *exclude_tags*: a set of tag names that should not be serialised FN) with_comments strip_textrewrite_prefixesqname_aware_tagsqname_aware_attrs exclude_attrs exclude_tagscX||_g|_||_||_|rt |nd|_|rt |nd|_||_|rt ||_nd|_|rt |j |_ nd|_ dgg|_ g|_ |s>|j tt|j gi|_dg|_d|_d|_d|_d|_dS)N)rArFr)_writer_with_comments _strip_textr_exclude_attrs _exclude_tags_rewrite_prefixes_qname_aware_tags intersection_find_qname_aware_attrs_declared_ns_stack _ns_stackr^rrr _prefix_map_preserve_space_pending_start _root_seen _root_done_ignored_depth) r3rr(r)r*r+r,r-r.s r&r5zC14NWriterTarget.__init__sE  +%4AKc-000t2>HS...D!1  *%()9%:%:D " "%)D "  0+./@+A+A+ND ( (+/D ( <$ #  @ N ! !$~';';'='=">"> ? ? ? b!!! %w"r%c#:K||D] }|r|Ed{V dSrCr$)r3ns_stack _reversedrps r&_iter_namespacesz!C14NWriterTarget._iter_namespaces7sJ#)H-- & &J &%%%%%%%% & &r%c|dd\}}||jD]\}}||kr d|d|cStd|d|d)NrrrrzPrefix z of QName "" is not declared in scope)splitrDr:r)r3 prefixed_namerrrps r&_resolve_prefix_namez%C14NWriterTarget._resolve_prefix_name<s$**322 ++DN;; * *FCF{{)C))4)))))_6__m___```r%c|4|dddkr|ddddnd|f\}}n|}t}||jD]4\}}||kr||vr|r|d|n|||fcS||5|jrd||jvr|j|}n!dt|jx}|j|<|jd||f|d|||fS|s d|vr|||fS||j D]=\}}||kr2|jd||f|r|d|n|||fcS>|s|||fStd|d ) Nrrrrrrrcz Namespace "rF) rrrDr9addr5r;rHr^r:r)r3rrr( prefixes_seenurs r&_qnamezC14NWriterTarget._qnameCs$ ;38!93C3CuQRRy''Q///"eHCC ..t/FGG & &IAvCxxF-77,2;&((3(((S#EEEE   f % % % %  ! /d&&&)#.1LS9I5J5J1L1LL)#.  #B ' . .V} = = =$$s$$c3. . !r..S= ..t~>> F FIAvCxx'+22C=AAA,2;&((3(((S#EEEE !S= FsFFFGGGr%cL|js|j|dSdSrC)r@rr^rs r&rzC14NWriterTarget.datahs3" $ J  d # # # # # $ $r%rcd||j}|jdd=|jr!|jds|}|j7|jdc}|_|rt |r|nd}|jg||R|dS|r+|jr&|t|dSdSdSNrc) rr2r<rjr=_looks_like_prefix_namerr>r0_escape_cdata_c14n)r3 _join_textrr qname_texts r&rzC14NWriterTarget._flushlsz$*%% JqqqM   D$8$< ::<D  F C/////r%cj"|r fd|D}|h|}i}|/|x}||<||jh|rf|}|rL|D]H} || } t | r/| x}|| <||Ind}nd}jfdt|dD} |r!d|D} | ng} |rlt|D]J\} }|| |vr||vr| ||d}| | \}} }| |r|n| |fK| d}j |r|dkn j d j }|d | |dz| r(|d d | D|d |*|t| ||dd_j gdS)Nc.i|]\}}|jv||Sr$)r3).0rrr3s r& z+C14NWriterTarget._start..s,TTTdaq@S7S7SQ7S7S7Sr%c(i|]}||Sr$r$)r\r parse_qnames r&r]z+C14NWriterTarget._start..s/444qKKNN444r%c.|ddS)Nrr)rG)rs r&rz)C14NWriterTarget._start..s!''#q//r%rc*g|]\}}|rd|znd|fS)zxmlns:xmlnsr$)r\rrs r& z+C14NWriterTarget._start..s@C'-9F""'3?r%rz+{http://www.w3.org/XML/1998/namespace}spacepreservercrrc@g|]\}}d|dt|dS)rrr)_escape_attrib_c14n)r\rrs r&rcz+C14NWriterTarget._start..s9TTT$!Q=q==$7$:$:===TTTr%rT)r3rrJrLr8rSrOrsortr^r|r<r0rrTr>r:)r3r(rrYrVrresolved_namesrqattrs attr_namer parsed_qnamesrrr attr_qnamerspace_behaviourrr_s` @r&rzC14NWriterTarget._starts6   *u *TTTTekkmmTTTE  !151J1J:1V1V VEN:. JJu     ' 3 311%88F !'**I!),E.u55*8<8Q8QRW8X8XXu 5 5))) * Fk 4444F 11535353444   #1I NN    I  Hu{{}}-- H H1%!v++!~:M:M%nQ&78;A-:1-=* Is  "B**A!FGGGG ))$QRR ##-< *Oz ) )%b) + + +   cM#&q))***  W E"''TT)TTTUU V V V c   ! E$]>*3M%Nq%QRR S S S b!!!!!r%c|jr|xjdzc_dS|jr||d||dd|jt|jdk|_|j |j dS)Nrrrr) r@rrr0rOr<rrHr?r9r:rs r&rzC14NWriterTarget.ends      1 $   F :  KKMMM /S))!,///000   """d233q8 ##%%% r%c0|jsdS|jrdS|jr|dn"|jr|jr||dt|d|js|ddSdS)Nrz)r1r@r?r0r>rrrTrs r&rzC14NWriterTarget.comments"  F    F ?  KK     _   KKMMM 8-d33888999  KK       r%c4|jrdS|jr|dn"|jr|jr|||rd|dt |dnd|d|js|ddSdS)Nrz)r@r?r0r>rrrT)r3rrs r&rzC14NWriterTarget.pis    F ?  KK     _   KKMMM :> S 6 6 6,T22 6 6 6 6OOOO U U U  KK       r%rC)r r!r"r#r5reversedrDrJrOrrrrrrrrrr$r%r&rrs, %"&$#$# # # # # J4<&&&& aaa#H#H#H#HJ$$$!# 2 2 2 2111000"C"C"C"C"J           r%rc& d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw) NrErFrrGrrHrN rIrs r&rTrTs) $;;<<W--D $;;<<V,,D $;;<<V,,D 4<<<<g..D ~ &)))"4(((((()sA)A,, BBc d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}d |vr|d d }d |vr|d d }|S#ttf$rt|YdSwxYw) NrErFrrGrrMrOz rz rNrsrIrs r&rfrfs) $;;<<W--D $;;<<V,,D $;;<<X..D 4<<<<g..D 4<<<<g..D 4<<<<g..D ~ &)))"4(((((()sBB CC)r)_set_factoriesrCr)rfr)@r#__all__rrdr:r=rrcollections.abcrrrrrr r rrrrr rrcontextmanagerrrrr4r2rrrrrrrr3rrrXrrrr r rrrrrrrrcompileUNICODEr;rSrrTrfrg _elementtreerurr$r%r&r|s'!!P   (             ### jjjjjjjjZ $&$     +"+"+"+"+"+"+"+"`_/_/_/_/_/_/_/_/H /+/+/+b;;;;z0(0(0(d 0(0(0(d    !!!*-2$*38(.(,16(,  %3!   ))) )))8 ) ) )!T"&0b'" !%&*     &////l    5555p77777777t",     $vvvvvvvvth?h?h?h?h?h?h?h?Z7tt77777<%"*\2:>>DD)))&))). 3K++++++N7122222   DD s E77F?FPKN\H`##3etree/__pycache__/ElementTree.cpython-311.opt-2.pycnu[ !A?h" gdZdZddlZddlZddlZddlZddlZddlZddlZddl Z ddl m Z Gdde Z dZGd d Zifd ZdCd ZdCd ZeZGddZGddZejdZdCdZdZhdZdZdZeeedZdZddddddd d!Zee_d"Z d#Z!d$Z"d%Z#dDddd&d'd(Z$Gd)d*ej%Z&dDddd&d'd+Z'd,Z(dEd.Z)dCd/Z*dDd0Z+Gd1d2Z,dCd3Z-dCd4Z.e-Z/dCd5Z0Gd6d7Z1Gd8d9Z2dCddd:d;Z3ej4dZ8d?Z9d@Z: eZ;ddAl$rYdSwxYw)F)CommentdumpElement ElementTree fromstringfromstringlistindent iselement iterparseparse ParseErrorPIProcessingInstructionQName SubElementtostring tostringlist TreeBuilderVERSIONXMLXMLID XMLParser XMLPullParserregister_namespace canonicalizeC14NWriterTargetz1.3.0N) ElementPathceZdZ dS)r N)__name__ __module__ __qualname__B/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementTree.pyr r ks Dr$r c$ t|dS)Ntag)hasattr)elements r%r r ys< 7E " ""r$ceZdZ dZ dZ dZ dZ ifdZdZdZ dZ dZ dZ dZ d Zd Zd Zd Zd ZdZdZdZddZddZddZddZdZddZdZdZdZddZdZ dS)rNc t|tstd|jj||_i|||_g|_dS)Nzattrib must be dict, not ) isinstancedict TypeError __class__r r'attrib _children)selfr'r0extras r%__init__zElement.__init__s\&$'' -) )),-- -))5) r$cJd|jj|jt|fzS)Nz<%s %r at %#x>)r/r r'idr2s r%__repr__zElement.__repr__s!4>#:DHbhh"OOOr$c0 |||SN)r/)r2r'r0s r% makeelementzElement.makeelements ~~c6***r$c` tjdt|S)Nz7elem.copy() is deprecated. Use copy.copy(elem) instead.)warningswarnDeprecationWarning__copy__r7s r%copyz Element.copys3  E    }}r$c||j|j}|j|_|j|_||dd<|Sr:)r;r'r0texttail)r2elems r%r@zElement.__copy__s?$+66I I QQQ r$c*t|jSr:)lenr1r7s r%__len__zElement.__len__s4>"""r$cjtjdtdt|jdkS)NzyThe behavior of this method will change in future versions. Use specific 'len(elem)' or 'elem is not None' test instead. stacklevelr)r=r> FutureWarningrGr1r7s r%__bool__zElement.__bool__s=  K a     4>""a''r$c|j|Sr:r1r2indexs r% __getitem__zElement.__getitem__s~e$$r$ct|tr|D]}||n||||j|<dSr:)r,slice_assert_is_elementr1)r2rRr)elts r% __setitem__zElement.__setitem__sg eU # # - - -'',,,, -  # #G , , , 'ur$c|j|=dSr:rPrQs r% __delitem__zElement.__delitem__s N5 ! ! !r$cf |||j|dSr:rVr1appendr2 subelements r%r]zElement.appends9   +++ j)))))r$cp |D]1}|||j|2dSr:r\)r2elementsr)s r%extendzElement.extendsO   + +G  # #G , , , N ! !' * * * * + +r$ch |||j||dSr:)rVr1insert)r2rRr_s r%rdzElement.inserts76  +++ eZ00000r$cxt|ts$tdt|jzdS)Nzexpected an Element, not %s)r, _Element_Pyr.typer )r2es r%rVzElement._assert_is_elements@![)) N9DGG tt}||_|Sr:)rrrC)rCr)s r%rrs"gGGL Nr$cf tt}||_|r|jdz|z|_|S)N )rrrC)targetrCr)s r%rrs>+,,GGL 1|c)D0 Nr$cHeZdZ d dZdZdZdZdZdZdZ d Z d Z dS) rNc(|rd|d|}||_dS)N{}rC)r2 text_or_urir's r%r4zQName.__init__s*  8 8&1kk337K r$c|jSr:rr7s r%__str__z QName.__str__s yr$c2d|jjd|jdS)N)r/r rCr7s r%r8zQName.__repr__s  N333TYYY??r$c*t|jSr:)hashrCr7s r%__hash__zQName.__hash__sDIr$cbt|tr|j|jkS|j|kSr:r,rrCr2others r%__le__z QName.__le__0 eU # # +9 * *yE!!r$cbt|tr|j|jkS|j|kSr:rrs r%__lt__z QName.__lt__0 eU # # *9uz) )y5  r$cbt|tr|j|jkS|j|kSr:rrs r%__ge__z QName.__ge__rr$cbt|tr|j|jkS|j|kSr:rrs r%__gt__z QName.__gt__rr$cbt|tr|j|jkS|j|kSr:rrs r%__eq__z QName.__eq__rr$r:) r r!r"r4rr8rrrrrrr#r$r%rrs     @@@"""!!!"""!!!"""""r$rcpeZdZ ddZdZdZddZddZddZddZ dd Z dd Z dd d d Z dZ dS)rNcF||_|r||dSdSr:)_rootr )r2r)files r%r4zElementTree.__init__s3   JJt       r$c |jSr:rr7s r%getrootzElementTree.getroots /zr$c ||_dSr:r)r2r)s r%_setrootzElementTree._setroot#s  r$c d}t|dst|d}d} |Vt}t|dr8|||_|j|r|SS |d}|sn||.||_|j|r|SS#|r|wwxYw)NFreadrbT _parse_wholei)r(openrrrcloserfeed)r2sourceparser close_sourcedatas r%r zElementTree.parse-s  vv&& &$''FL ~"6>22& "(!4!4V!c8 |j|Sr:)rrr2r's r%rzElementTree.iterRs zs###r$c |dddkr$d|z}tjd|ztd|j||SNr/.zThis search is broken in 1.3 and earlier, and will be fixed in a future version. If you rely on the current behaviour, change it to %rrJrK)r=r>rMrrlrms r%rlzElementTree.find^sh  8s??:D M-/34!      ztZ000r$c |dddkr$d|z}tjd|ztd|j|||Sr)r=r>rMrrqrrs r%rqzElementTree.findtexttsl  8s??:D M-/34!      z""4*===r$c |dddkr$d|z}tjd|ztd|j||Sr)r=r>rMrrurms r%ruzElementTree.findallsj  8s??:D M-/34!      z!!$ 333r$c |dddkr$d|z}tjd|ztd|j||Sr)r=r>rMrrwrms r%rwzElementTree.iterfindsj  8s??:D M-/34!      z""4444r$Tshort_empty_elementsc |sd}n|tvrtd|z|s |dkrd}nd}t||5\}}|dkrA|s0|=|dkr%|dvr|d|d |d krt ||jn:t |j|\} } t|} | ||j| | | ddddS#1swxYwYdS) Nxmlzunknown method %rc14nutf-8us-asciiunicode)rrz rCr) _serialize ValueError _get_writerlower_serialize_textr _namespaces) r2file_or_filenameencodingxml_declarationdefault_namespacemethodrwritedeclared_encodingqnamesro serializes r%rzElementTree.writes  . ;FF : % %069:: : &"% )8 4 4 E8R@QO$,^^%%22&,,..6KKK%%%()))tz2222%0=N%O%O" &v.  %VZ/CEEEE E E E E E E E E E E E E E E E E E EsB!C--C14C1c0||dS)Nr)r)r)r2rs r% write_c14nzElementTree.write_c14nszz$vz...r$rr:)NNNN)r r!r"r4rrr rrlrqrurwrrr#r$r%rrs   ####J $ $ $ $1111,>>>>,4444,5555." $ 3E $( 3E3E3E3E3Ej/////r$rc#xK |j}|dkr|t|ddpdfVdStj5}t |t jr|}nt |t jr/t j |}| |j nLt j}d|_ ||_ |j |_ |j|_n#t$rYnwxYwt j||dd}| |j |j|fVddddS#1swxYwYdS#t$rV|dkrd}t#|d|d 5}|j|fVdddYdS#1swxYwYYdSwxYw) NrrrcdSNTr#r#r$r%z_get_writer..sDr$xmlcharrefreplace )rerrorsnewlinew)rr)rrgetattr contextlib ExitStackr,ioBufferedIOBase RawIOBaseBufferedWritercallbackdetachwritableseekabletellAttributeError TextIOWrapperr)rrrstackrs r%rrs-+ & >>  y ( (!1:tDDOO O O O O O%'' +5.0ABB+DD 0",??,-=>>DNN4;////,..D$0LDM!&DJ)9(A $4$9 )'19/B04666 t{+++j(****9 + + + + + + + + + + + + + + + + + + ''' >>  y ( (H "C(,... '15*h& & & & ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' 'smEB E C21E 2 C?<E >C??AE  EE7F9 F* F9*F. .F91F. 2F98F9cddiird<fd}|D])}|j}t|tr|jvr||jnHt|t r|vr ||n#|!|t ur|turt|| D]^\}}t|tr|j}|vr ||t|tr|jvr||j_|j}t|tr|jvr||j+fS)Nc |dddkr|dddd\}}|}|9t|}|dtz}|dkr||<|r |d||<dS||<dSrt d||<dS#t $rt |YdSwxYw)Nrrrzns%dr:z.add_qname/s .RaRyC 9++C33S#,,>+//44F~!'#j//!9*0 3(/5vvss$;F5MMM$'F5MMM$$3!&u  . . . &u - - - - - - .sB B/B/B//C  C ) rr'r,rrCrrr rr) rErrr'r|r~rCrors ` @@r%rr$sD\FJ+(* $%.......8 !!h c5 ! ! ,xv%% #(### S ! ! ,&   # _G!3!32 &s + + +**,, & &JC#u%% h&   #%'' &EJf,D,D %*%%%y dE " " !ty'>'> Idi : r$c |j}|j}|tur|d|zn|tur|d|zn||}|5|r|t ||D]}t |||d|na|d|zt |} | s|r|rPt|dD]+\} } | rd| z} |d| d t| d ,| D]k\} } t| tr| j} t| tr|| j} nt| } |d || d | d l|st|s|sP|d |r|t ||D]}t |||d||d |zd zn |d|j r|t |j dSdS)N rrc|dSNrr#xs r%rz _serialize_xml..w QqTr$r|r xmlns=""rr)r'rCrr _escape_cdata_serialize_xmllistrsorted_escape_attribr,rrGrD) rrErrorkwargsr'rCrhrvks r%rras (C 9D g~~ kD !!!! % % % hoSk ; +mD))*** J Jua4HJJJJJ J E#)   &&E 9  9 &z'7'7'9'9+9>!;!;!;1( #aAAA*1----"99DAq!!U++#F!!U++."16N*1--EE&)))QQQ78888 s4yy (< c /E---...NNA"5!VT8LNNNNNdSj3&''''e  y( mDI&&'''''((r$>brhrcolimgwbrareabaselinkmetaembedframeinputparamtrackrisindexbasefontc j|j}|j}|tur|dt|zn|tur|dt|zn||}|3|r|t||D]}t |||dnu|d|zt |}|s|r|rPt|dD]+\} } | rd| z} |d| dt| d ,|D]k\} } t| tr| j} t| tr|| j} nt| } |d || d| d l|d | } |r0| d ks| d kr ||n|t||D]}t |||d| tvr|d|zd z|jr|t|jdSdS)Nr r rc|dSr r#r s r%rz!_serialize_html..rr$rrrrrrrscriptstyler)r'rCrrr_serialize_htmlrrrrr,r_escape_attrib_htmlr HTML_EMPTYrD) rrErrorr'rCrhrrrltags r%r1r1s (C 9D g~~ kM$///0000 % % % ht,,,----Sk ; +mD))*** 8 8q&$7777 8 E#)   &&E 9  9 &z'7'7'9'9+9>!;!;!;1( #aAAA*1----"99DAq!!U++#F!!U++3"16N/22EE&)))QQQ78888 E#JJJ99;;D /8##twE$KKKKE---... 8 8q&$7777:%%dSj3&''' y( mDI&&'''''((r$c||D] }|||jr||jdSdSr:)rrD)rrEparts r%rrsT  d  y dir$)rhtmlrCc tjd|rtdttD]\}}||ks||krt|=|t|<dS)Nzns\d+$z'Prefix format reserved for internal use)rematchrrrr)rrrrs r%rrs~  x 6""DBCCC^))++,,""1 88qF{{q! N3r$rr7rdfwsdlxsxsidc)$http://www.w3.org/XML/1998/namespacezhttp://www.w3.org/1999/xhtmlz+http://www.w3.org/1999/02/22-rdf-syntax-ns#z http://schemas.xmlsoap.org/wsdl/z http://www.w3.org/2001/XMLSchemaz)http://www.w3.org/2001/XMLSchema-instancez http://purl.org/dc/elements/1.1/cRtd|dt|jd)Nzcannot serialize z (type ))r.rgr rs r%rrs1 )+/44d1D1D1DE   r$c d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw)N&&r<r>replacer.rrrs r%rrs ) $;;<<W--D $;;<<V,,D $;;<<V,,D ~ &)))"4(((((()AA A65A6c d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}d |vr|d d }d |vr|d d }d |vr|d d}|S#ttf$rt|YdSwxYw)NrDrErrFrrGr" z rz  z rHrs r%rrs ) $;;<<W--D $;;<<V,,D $;;<<V,,D 4<<<<h//D 4<<<<g..D 4<<<<g..D 4<<<<g..D ~ &)))"4(((((()sB7B:: CCc d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw)NrDrErrGrrLrHrs r%r2r2+s ) $;;<<W--D $;;<<V,,D 4<<<<h//D ~ &)))"4(((((()rJT)rrrc |dkrtjntj}t||||||||S)Nrrrrr)rStringIOBytesIOrrgetvalue)r)rrrrrstreams r%rr:sr ')33R[]]]Fvx/>1B&,4H JJJ ??  r$c.eZdZ dZdZdZdZdZdS)_ListDataStreamc||_dSr:)lst)r2rYs r%r4z_ListDataStream.__init__Ts r$cdSrr#r7s r%rz_ListDataStream.writableWtr$cdSrr#r7s r%rz_ListDataStream.seekableZr[r$c:|j|dSr:)rYr])r2bs r%rz_ListDataStream.write]s r$c*t|jSr:)rGrYr7s r%rz_ListDataStream.tell`s48}}r$N)r r!r"r4rrrrr#r$r%rWrWRsbAr$rWcxg}t|}t||||||||S)NrQ)rWrr)r)rrrrrrYrUs r%rrcsU C S ! !Fvx/>1B&,4H JJJ Jr$c" t|tst|}|tjd|j}|r |ddkr!tjddSdS)Nr)rr)r,rrsysstdoutrrD)rErDs r%rrps dK ( (!4  JJszIJ... <<>> D 48t## $#r$ c t|tr|}|dkrtd|t |sdSd|zzgfd|ddS)Nrz,Initial indentation level must be >= 0, got rc|dz} |}n0#t$r#|z}|YnwxYw|jr|js||_|D]D}t |r |||jr|js||_E|js||_dSdSr ) IndexErrorr]rCstriprGrD)rElevel child_levelchild_indentationchild_indent_children indentationsspaces r%rnz indent.._indent_childrensai  3 ,[ 9   3 3 3 ,U 3e ;     1 2 2 2 2 2 3y *  1 1 *)DI / /E5zz 5   444: /UZ%5%5%7%7 /. z!! -%e,EJJJ - -s *>>)r,rrrrG)treerprjrnros ` @@r%rrs $ $$||~~ qyyOOOPPP t9955=()L-------,T1r$cP t}||||Sr:)rr )rrrqs r%r r s+ ==DJJvv Kr$c t||tdstddndfdGfddtjj}|}d|_tj||S) N)events_parserrrTFc3K Ed{V|d}|sn|H}Ed{V}|||_r|dSdS#r|wwxYw)NTi@) read_eventsrr_close_and_return_rootrootr)rrryitr pullparserwrs r%iteratorziterparse..iterators  &%11333333333{{9--%%%  &4466D!--// / / / / / / /B~    |   s B B))Cc<eZdZjZfdZdS)$iterparse..IterParseIteratorc8rdSdSr:)r)r2rrs r%__del__z,iterparse..IterParseIterator.__del__s&    r$N)r r!r"__next__r)rr}rsr%IterParseIteratorrsE8F##,        r$r) rr(r collectionsabcIteratorryweakrefref) rrtrrrzrr}r{r|s ` @@@@r%r r s  ff===J 66 " "fd##  $KO4    BBG RB Ir$c:eZdZd dddZdZdZdZdZdZdS) rN)ructj|_|ptt |_|d}|j|j|dS)Nr)end)rdeque _events_queuerrru _setevents)r2rtrus r%r4zXMLPullParser.__init__s[ ).00A);=="A"A"A >F  2F;;;;;r$c |jtd|rO |j|dS#t$r%}|j|Yd}~dSd}~wwxYwdS)Nz!feed() called after end of stream)rurr SyntaxErrorrr])r2rexcs r%rzXMLPullParser.feed s* < @AA A  / / !!$''''' / / /"))#......... / / /s7 A&A!!A&cF|j}d|_|Sr:)rur)r2rys r%rxz$XMLPullParser._close_and_return_roots!|!!##  r$c0 |dSr:)rxr7s r%rzXMLPullParser.closes! ##%%%%%r$c#K |j}|r3|}t|tr||V|1dSdSr:)rpopleftr, Exception)r2rtevents r%rwzXMLPullParser.read_events%sj # NN$$E%++        r$cd|jtd|jdS)Nz"flush() called after end of stream)rurflushr7s r%rzXMLPullParser.flush3s3 < ABB B r$r:) r r!r"r4rrxrrwrr#r$r%rrs >r$c |stt}|||}i}|D]}|d}|r|||<||fS)Nrr6)rrrrrr{)rCrrqidsrEr6s r%rrJs 1+--000 KK <<>>D C  XXd^^  CG 9r$c |stt}|D]}|||Srr)sequencerrCs r%rrbsW 1+--000 D <<>>r$cVeZdZ d ddddddZdZdZdZdZd Zd Z d d Z d Z dS)rNF)comment_factory pi_factoryinsert_comments insert_piscg|_g|_d|_d|_d|_|t }||_||_|t}||_ ||_ |t}||_ dSr:) _data_elem_lastr_tailr_comment_factoryrr _pi_factoryrr_factory)r2element_factoryrrrrs r%r4zTreeBuilder.__init__sr      "%O /.  .J%$  "%O' r$c |jSr:rr7s r%rzTreeBuilder.closesIzr$c|jrJ|j:d|j}|jr ||j_n ||j_g|_dSdSNr)rrjoinrrDrCr2rCs r%_flushzTreeBuilder._flushs\ : z%wwtz**:+&*DJOO'+DJODJJJ  r$c< |j|dSr:)rr]r2rs r%rzTreeBuilder.datas!* $r$c ||||x|_}|jr!|jd|n|j||_|j|d|_|S)Nrbr)rrrrr]rr)r2r'attrsrEs r%startzTreeBuilder.starts  MM#u555 T :  JrN ! !$ ' ' ' ' Z DJ $  r$c ||j|_d|_|jSr )rrpoprrrs r%rzTreeBuilder.ends: Z^^%%  zr$cF ||j|j|Sr:)_handle_singlerrrs r%commentzTreeBuilder.comments. ""  !4#7?? ?r$cH ||j|j||Sr:)rrr)r2rrCs r%pizTreeBuilder.pis/ ""  dovt== =r$c||}|rI|||_|jr |jd|d|_|S)Nrbr)rrrr]r)r2factoryrdargsrEs r%rzTreeBuilder._handle_singlesYw~   KKMMMDJz , 2%%d+++DJ r$r:) r r!r"r4rrrrrrrrr#r$r%rrts&(!%$!&5((((((      "   ???====r$rc`eZdZ ddddZdZdZdZdZdZd Z d Z d Z d Z d Z dZdS)rN)rrc@ ddlm}n3#t$r& ddl}n#t$rtdwxYwYnwxYw||d}|t }|x|_|_|x|_|_ |j |_ i|_ |j |_t|dr |j|_t|dr |j|_t|dr |j|_t|dr |j|_t|d r |j|_t|d r |j|_t|d r |j|_d |_d |_d|_ i|_! d |j"z|_#dS#tH$rYdSwxYw)Nrexpatz7No module named expat; use SimpleXMLTreeBuilder insteadrrrstart_nsend_nsrrrrzExpat %d.%d.%d)% xml.parsersr ImportErrorpyexpat ParserCreaterrrur_targeterror_error_names_defaultDefaultHandlerExpandr(_startStartElementHandler_endEndElementHandler _start_nsStartNamespaceDeclHandler_end_nsEndNamespaceDeclHandlerrCharacterDataHandlerrCommentHandlerrProcessingInstructionHandler buffer_textordered_attributes_doctypeentity version_infoversionr)r2rrrrs r%r4zXMLParser.__init__s  ) ) ) ) ) ) )    '''''   !M (' ##Hc22 > ]]F%++ dl%++ dlk  &*m# 67 # # 5)-F & 65 ! ! 1'+yF $ 6: & & >/3~F , 68 $ $ :-1\F * 66 " " 6*0+F ' 69 % % 3$*NF ! 64  <28)F /$%!   +e.@@DLLL    DD s. 99399>F FFc|j}|j}|D]}|dkrd|_|||jfd}||_#|dkr|||jfd}||_=|dkr0t|jdr |||j fd}n||fd }||_ s|d kr0t|jd r |||j fd }n||fd }||_ |dkr|||fd}||_ |dkr|||fd}||_td|zdS)Nrrc4|||||fdSr:r#)r' attrib_inrr]rs r%handlerz%XMLParser._setevents..handler1s)FE55i#8#89:::::r$rc2||||fdSr:r#)r'rr]rs r%rz%XMLParser._setevents..handler6s%FE33s88,-----r$zstart-nsrc4|||||fdSr:r#)rrrr]rs r%rz%XMLParser._setevents..handler=s)xx'<'<=>>>>>r$c,|||pd|pdffdSrr#)rrrr]s r%rz%XMLParser._setevents..handlerAs* "ciR'@ABBBBBr$zend-nsrc2||||fdSr:r#)rrr]rs r%rz%XMLParser._setevents..handlerGs%vvf~~677777r$c ||dfdSr:r#)rrr]s r%rz%XMLParser._setevents..handlerKst}-----r$rcP|||j|fdSr:)rr)rCrr]r2s r%rz%XMLParser._setevents..handlerOs-FE4;#6#6t#<#<=>>>>>r$rcR|||j||fdSr:)rr) pi_targetrrr]r2s r%rz%XMLParser._setevents..handlerSs-FE4;>>)T#B#BCDDDDDr$zunknown event %r)rur]rrrrrr(rrrrrrrr)r2 events_queueevents_to_reportrr] event_namers r%rzXMLParser._setevents%s$** B* BJW$$,-)2fCCCC3:00x''4;11..8'+|88888/9....18..y(((26????(/%%t##3=f!%EEEE7>33 !3j!@AAAU* B* Br$cbt|}|j|_|j|jf|_|r:)r codelinenooffsetposition)r2r~errs r% _raiseerrorzXMLParser._raiseerrorZs-:|U\1  r$cn |j|}n%#t$r|}d|vrd|z}||j|<YnwxYw|S)Nrr)rKeyError)r2r|names r%_fixnamezXMLParser._fixname`s` $;s#DD $ $ $Dd{{Tz#DK     $  s 22c@|j|pd|pdSr)rrr2rrs r%rzXMLParser._start_nsks"{##FLb#)<<tdt|dD]}||dz||||< |j||S)NrrJr)rrangerGrr)r2r' attr_listfixnamer0is r%rzXMLParser._startqs-gcll  ?1c)nna00 ? ?09!A#wwy|,,--{  f---r$c\|j||Sr:)rrrrs r%rzXMLParser._end}s"{t}}S11222r$c|dd}|dkr |jj}n#t$rYdSwxYw ||j|dddS#t$raddlm}|d||jj |jj fz}d|_ |jj |_ |jj |_ |wxYw|dkr|dd d kr g|_dS|j|d kr d|_dS|}|sdS|j|t#|j}|d kr|jd}|d kr|dkr|j\}}} } | r | dd} n|dkr|dkr|j\}}} d} ndSt%|jdr%|j|| | ddn*t%|drt)jdt,d|_dSdSdS)NrrDrbrrz'undefined entity %s: line %d, column %d r z RuntimeWarning) r2rCr data_handlerrrnrgrpubidsystems r%rzXMLParser._defaults}bqb S== #{/ !      T[ad455555   ------kk=4;6K133 ![8 ![:   s]]tBQBx;66DMMM ] &}} $ ::< AAA A* B* A74B6A77B Bcp|j} |jd|jddn,#|j$r}||Yd}~nd}~wwxYw|j|dS#|j|wxYw)NFr$)rGetReparseDeferralEnabledSetReparseDeferralEnabledrrr)r2 was_enabledrs r%rzXMLParser.flushsk;;==  ? K 1 1% 8 8 8 K  c5 ) ) ) ){     Q          K 1 1+ > > > > >DK 1 1+ > > > >s/5AB A:A50B5A::BB5)r r!r"r4rrrrrrrrrrrr#r$r%rrs"&+++++Z3B3B3Bj   ===000 . . .3334%4%4%l   ***"?????r$r)out from_filec J ||tdd}|tjx}}tt |jfi|}|*|||n|t|||| ndS)Nz:Either 'xml_data' or 'from_file' must be provided as inputr)r) rrrRrrrrrr rT)xml_datar r!optionssiors r%rrs I-UVVV C {KMM!c .syDDGDD E E EF H    i'''' _3<<>>>$6r$z ^\w+:\w+$ceZdZ dddddddddZefdZdZddZdZd j fd Z d Z d Z dd Z dZdZdZdS)rFN) with_comments strip_textrewrite_prefixesqname_aware_tagsqname_aware_attrs exclude_attrs exclude_tagscX||_g|_||_||_|rt |nd|_|rt |nd|_||_|rt ||_nd|_|rt |j |_ nd|_ dgg|_ g|_ |s>|j tt|j gi|_dg|_d|_d|_d|_d|_dS)N)r@rFr)_writer_with_comments _strip_textr_exclude_attrs _exclude_tags_rewrite_prefixes_qname_aware_tags intersection_find_qname_aware_attrs_declared_ns_stack _ns_stackr]rrr _prefix_map_preserve_space_pending_start _root_seen _root_done_ignored_depth) r2rr'r(r)r*r+r,r-s r%r4zC14NWriterTarget.__init__sE  +%4AKc-000t2>HS...D!1  *%()9%:%:D " "%)D "  0+./@+A+A+ND ( (+/D ( <$ #  @ N ! !$~';';'='=">"> ? ? ? b!!! %w"r$c#:K||D] }|r|Ed{V dSr:r#)r2ns_stack _reversedros r%_iter_namespacesz!C14NWriterTarget._iter_namespaces7sJ#)H-- & &J &%%%%%%%% & &r$c|dd\}}||jD]\}}||kr d|d|cStd|d|d)NrrrrzPrefix z of QName "" is not declared in scope)splitrCr9r)r2 prefixed_namerrrps r%_resolve_prefix_namez%C14NWriterTarget._resolve_prefix_name<s$**322 ++DN;; * *FCF{{)C))4)))))_6__m___```r$c|4|dddkr|ddddnd|f\}}n|}t}||jD]4\}}||kr||vr|r|d|n|||fcS||5|jrd||jvr|j|}n!dt|jx}|j|<|jd||f|d|||fS|s d|vr|||fS||j D]=\}}||kr2|jd||f|r|d|n|||fcS>|s|||fStd|d ) Nrrrrrrrbz Namespace "rE) rrrCr8addr4r:rGr]r9r)r2rrr' prefixes_seenurs r%_qnamezC14NWriterTarget._qnameCs$ ;38!93C3CuQRRy''Q///"eHCC ..t/FGG & &IAvCxxF-77,2;&((3(((S#EEEE   f % % % %  ! /d&&&)#.1LS9I5J5J1L1LL)#.  #B ' . .V} = = =$$s$$c3. . !r..S= ..t~>> F FIAvCxx'+22C=AAA,2;&((3(((S#EEEE !S= FsFFFGGGr$cL|js|j|dSdSr:)r?rr]rs r%rzC14NWriterTarget.datahs3" $ J  d # # # # # $ $r$rcd||j}|jdd=|jr!|jds|}|j7|jdc}|_|rt |r|nd}|jg||R|dS|r+|jr&|t|dSdSdSNrb) rr1r;rir<_looks_like_prefix_namerr=r/_escape_cdata_c14n)r2 _join_textrr qname_texts r%rzC14NWriterTarget._flushlsz$*%% JqqqM   D$8$< ::<D  F C/////r$cj"|r fd|D}|h|}i}|/|x}||<||jh|rf|}|rL|D]H} || } t | r/| x}|| <||Ind}nd}jfdt|dD} |r!d|D} | ng} |rlt|D]J\} }|| |vr||vr| ||d}| | \}} }| |r|n| |fK| d}j |r|dkn j d j }|d | |dz| r(|d d | D|d |*|t| ||dd_j gdS)Nc.i|]\}}|jv||Sr#)r2).0rrr2s r% z+C14NWriterTarget._start..s,TTTdaq@S7S7SQ7S7S7Sr$c(i|]}||Sr#r#)r[r parse_qnames r%r\z+C14NWriterTarget._start..s/444qKKNN444r$c.|ddS)Nrr)rF)rs r%rz)C14NWriterTarget._start..s!''#q//r$rc*g|]\}}|rd|znd|fS)zxmlns:xmlnsr#)r[rrs r% z+C14NWriterTarget._start..s@C'-9F""'3?r$rz+{http://www.w3.org/XML/1998/namespace}spacepreserverbrrc@g|]\}}d|dt|dS)rrr)_escape_attrib_c14n)r[rrs r%rbz+C14NWriterTarget._start..s9TTT$!Q=q==$7$:$:===TTTr$rT)r2rrIrKr7rRrNrsortr]r{r;r/rrSr=r9)r2r'rrXrUrresolved_namesrqattrs attr_namer~ parsed_qnamesrrr attr_qnamerspace_behaviourrr^s` @r%rzC14NWriterTarget._starts6   *u *TTTTekkmmTTTE  !151J1J:1V1V VEN:. JJu     ' 3 311%88F !'**I!),E.u55*8<8Q8QRW8X8XXu 5 5))) * Fk 4444F 11535353444   #1I NN    I  Hu{{}}-- H H1%!v++!~:M:M%nQ&78;A-:1-=* Is  "B**A!FGGGG ))$QRR ##-< *Oz ) )%b) + + +   cM#&q))***  W E"''TT)TTTUU V V V c   ! E$]>*3M%Nq%QRR S S S b!!!!!r$c|jr|xjdzc_dS|jr||d||dd|jt|jdk|_|j |j dS)Nrrrr) r?rrr/rNr;rrGr>r8r9rs r%rzC14NWriterTarget.ends      1 $   F :  KKMMM /S))!,///000   """d233q8 ##%%% r$c0|jsdS|jrdS|jr|dn"|jr|jr||dt|d|js|ddSdS)Nrz)r0r?r>r/r=rrrSrs r%rzC14NWriterTarget.comments"  F    F ?  KK     _   KKMMM 8-d33888999  KK       r$c4|jrdS|jr|dn"|jr|jr|||rd|dt |dnd|d|js|ddSdS)Nrz)r?r>r/r=rrrS)r2rrs r%rzC14NWriterTarget.pis    F ?  KK     _   KKMMM :> S 6 6 6,T22 6 6 6 6OOOO U U U  KK       r$r:)r r!r"r4reversedrCrIrNrrrrrrrrrr#r$r%rrs, %"&$#$# # # # # J4<&&&& aaa#H#H#H#HJ$$$!# 2 2 2 2111000"C"C"C"C"J           r$rc& d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}|S#ttf$rt|YdSwxYw) NrDrErrFrrGrM rHrs r%rSrSs) $;;<<W--D $;;<<V,,D $;;<<V,,D 4<<<<g..D ~ &)))"4(((((()sA)A,, BBc d|vr|dd}d|vr|dd}d|vr|dd}d|vr|dd}d |vr|d d }d |vr|d d }|S#ttf$rt|YdSwxYw) NrDrErrFrrLrNz rz rMrrrHrs r%reres) $;;<<W--D $;;<<V,,D $;;<<X..D 4<<<<g..D 4<<<<g..D 4<<<<g..D ~ &)))"4(((((()sBB CC)r)_set_factoriesr:r)rer)?__all__rrcr9r=rrcollections.abcrrrrrr r rrrrr rrcontextmanagerrrrr3r1rrrrrrrr2rrrWrrrr r rrrrrrrrcompileUNICODEr:rRrrSrerf _elementtreertrr#r$r%r{s"!P   (             ### jjjjjjjjZ $&$     +"+"+"+"+"+"+"+"`_/_/_/_/_/_/_/_/H /+/+/+b;;;;z0(0(0(d 0(0(0(d    !!!*-2$*38(.(,16(,  %3!   ))) )))8 ) ) )!T"&0b'" !%&*     &////l    5555p77777777t",     $vvvvvvvvth?h?h?h?h?h?h?h?Z7tt77777<%"*\2:>>DD)))&))). 3K++++++N7122222   DD s E66E?>E?PKN\xTK""0etree/__pycache__/ElementInclude.cpython-311.pycnu[ !A?hddlZddlmZddlmZdZedzZedzZdZGd d e Z Gd d e Z dd Z ddefdZ dZdS)N) ElementTree)urljoinz!{http://www.w3.org/2001/XInclude}includefallbackceZdZdS)FatalIncludeErrorN__name__ __module__ __qualname__E/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementInclude.pyr r CDrr ceZdZdS)LimitedRecursiveIncludeErrorNr rrrrrGrrrc4|dkrOt|d5}tj|}dddn #1swxYwYnB|sd}t|d|5}|}dddn #1swxYwY|S)NxmlrbzUTF-8r)encoding)openrparsegetrootread)hrefrrfiledatas rdefault_loaderr!Ws ~~ $   5$T**2244D 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 H $h / / / 499;;D                Ks#'A  AA,B  BBc|d}n|dkrtd|zt|dr|}|t}t ||||t dS)Nrz;expected non-negative depth or None for 'max_depth', got %rr) ValueErrorhasattrrr!_includeset)elemloaderbase_url max_depths rrrtsv QVYbbccctY||~~ ~ T68Y66666rcNd}|t|kr||}|jtkr|d}|rt ||}|dd}|dkr||vrt d|z|dkrt d|z|||||} | t d|d|tj| } t| |||d z || ||j r| j pd |j z| _ | ||<n|d kr}||||d } | t d|d||j r | |j z } |r||d z } | j pd | z| _ n|j pd | z|_ ||=t d |z|jtkrt d|jzt||||||d z }|t|k dSdS)Nrrrrzrecursive include of %sz5maximum xinclude depth reached when including file %sz cannot load z as rtextrz)unknown parse type in xi:include tag (%r)z0xi:fallback tag must be child of xi:include (%r))lentagXINCLUDE_INCLUDEgetrr raddcopyr&removetailr.XINCLUDE_FALLBACK) r(r)r*r+ _parent_hrefsierrnoder.s rr&r&s A c$ii-- G 5$ $ $55==D /x..EE'5))E~~=((+,E,LMMM>>6ORVVXXX!!$'''vdE**<++26$$>yvtY]MJJJ$$T***6;!%bAF :DIQ&vdE155+<+<==<++26$$>6#AFND9!9D!%bD 8DII!%bD 8DIG'?%GU' ' '#BQUJ  Q)] C C C Qg c$ii------r)N)r4r-r urllib.parserXINCLUDEr1r7DEFAULT_MAX_INCLUSION_DEPTH SyntaxErrorr rr!rr&rrrr@sf  .i'z)               #4      :1 7 7 7 766666rPKN\~h@eCeC3etree/__pycache__/ElementPath.cpython-311.opt-2.pycnu[ !A?h6ddlZejdZddZdZdZdZdZdZd Z d Z d Z d Z eee e e e d Z iZGddZddZddZddZddZdS)Nz`('[^']*'|\"[^\"]*\"|::|//?|\.\.|\(\)|!=|[/.*:\[\]\(\)@=])|((?:\{[^}]+\})?[^/\[\]\(\)@!=\s]+)|\s+c#K|r|dnd}d}t|D]}|\}}|r|ddkrsd|vrW|dd\}} |st|d||d|fVn6#t$rt d|zdwxYw|r|s |d|d|fVn|Vd}|V|d k}dS) NFr{:}z!prefix %r not found in prefix map@)getxpath_tokenizer_refindallsplitKeyError SyntaxError) pattern namespacesdefault_namespaceparsing_attributetokenttypetagprefixuris B/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementPath.pyxpath_tokenizerrJsY.8B r***d#++G44-- s  -3q6S==czz!iiQ// ^%'&%Z-?-?-?!EEEEEE^^^%&IF&RSSY]]^" +< e):):):CC@@@@@@ %  KKK %  %--s +BB%cv|j}|/ix|_}|jD] }|D]}|||< |SN) parent_maprootiter)contextrpes rget_parent_mapr#bs_#J*,,Z""$$ " "A " " ! 1  " c:|dddkp |dddkS)N{*}}*rs r_is_wildcard_tagr,ls' rr7e  /s233x4//r$cttcdkrfd}ndkrfd}ndddkr<ddtt dddfd}nPd dd kr0dd tdtfd }nt d |S)Nz{*}*c3@K|D]}|jr|VdSrr+)r resultelem _isinstance_strs rselectz_prepare_tag..selectvs@  ;tx..JJJ  r$z{}*c3\K|D]%}|j}|r|ddkr|V&dS)Nrrr+)r r/r0el_tagr1r2s rr3z_prepare_tag..select|sS  ;vt,,c1A1AJJJ  r$r&r'c3hK|D]+}|j}|ks|r|kr|V,dSrr+) r r/r0r5r1r2no_nssuffixrs rr3z_prepare_tag..selectsY  S==KK$=$==&-SYBYBYJJJ  r$r(r)c3\K|D]%}|j}|r|kr|V&dSrr+)r r/r0r5r1r2nsns_onlys rr3z_prepare_tag..selectsS  ;vt,,B1F1FJJJ  r$zinternal parser error, got ) isinstancestrslicelen RuntimeError)rr3r1r2r8r<r=r9s` @@@@@@r _prepare_tagrCpsi"CK f}}                RaRE  QRRs6{{lD))!""g           RSST   "Xc"gg&&          >>>??? Mr$c|dtrtfd}ndddkr ddfd}|S)Nrc4d}|||S)Nc3$K|D] }|Ed{V dSrr*)r/r0s r select_childz3prepare_child..select..select_childs2"$$D#OOOOOOOO$$r$r*r r/rG select_tags rr3zprepare_child..selects0 $ $ $:g||F';';<< K|D]}|D]}|jkr|VdSrr+r r/r0r"rs rr3zprepare_child..selectsI    Au||   r$)r,rCnextrr3rIrs @@r prepare_childrOs (C !#&&  = = = = = = rr7d??abb'C     Mr$c d}|S)Nc3$K|D] }|Ed{V dSrr*)r r/r0s rr3zprepare_star..selects2  DOOOOOOOO  r$r*rNrr3s r prepare_starrSs Mr$c d}|S)Nc3K|Ed{VdSrr*)r r/s rr3zprepare_self..selects$r$r*rRs r prepare_selfrVs Mr$c$ |}n#t$rYdSwxYw|ddkrdn |ds |dntdtrtfd}ndddkr ddfd}|S) Nr*rzinvalid descendantc4d}|||S)Nc3RK|D]!}|D] }||ur|V "dSrr)r/r0r"s rrGz8prepare_descendant..select..select_childsN"$$D!YY[[$$D=="#GGG$$$r$r*rHs rr3z"prepare_descendant..selects0 $ $ $ :g||F';';<< .selectsQ  3  A}}   r$) StopIterationrr,rCrMs @@rprepare_descendantr^s  Qx3 1X0Ah./// !#&&  = = = = = = rr7d??abb'C     Ms  c d}|S)Nc3hKt|}i}|D]}||vr||}||vr d||<|VdSr)r#)r r/r result_mapr0parents rr3zprepare_parent..selectse#G,,   ! !Dz!!#D)++)-Jv& LLL  ! !r$r*rRs rprepare_parentrcs ! ! ! Mr$c g}g} |}n#t$rYdSwxYw|ddkrnl|dkr2|dr$|ddddvrd|dddf}||dpd||dd |}|d kr|dfd }|S|d ks|d kr$|d|d  fd} fd}d|vr|n|S|dkr*tjd|ds|dfd}|S|dks-|dks'|dks|dkrLtjd|ds1|d|d r  fd} fd}n fd} fd}d|vr|n|S|dks |dks|dkr|dkr.t |ddz dkrt dnp|ddkrt d|dkrM t |d dz n#t$rt d!wxYwd"krt d#ndfd$}|St d%)&Nrr])rrz'"'r:-rz@-c3HK|D]}||VdSrr )r r/r0keys rr3z!prepare_predicate..selects:  88C==,JJJ  r$z@-='z@-!='c3PK|D]}|kr|V dSrri)r r/r0rjvalues rr3z!prepare_predicate..selects?  88C==E))JJJ  r$c3XK|D]#}|x} |kr|V$dSrri)r r/r0 attr_valuerjrls rselect_negatedz)prepare_predicate..select_negatedsI  "&((3--/J<uATATJJJ  r$z!=z\-?\d+$c3HK|D]}||VdSr)find)r r/r0rs rr3z!prepare_predicate..selects:  99S>>-JJJ  r$z.='z.!='z-='z-!='c3K|D]K}|D]3}d|kr|Vn4LdSNr)r joinitertextr r/r0r"rrls rr3z!prepare_predicate..selectsn"""D!\\#..""771::<<00E99"&JJJ!E:""r$c3K|D]K}|D]3}d|kr|Vn4LdSrs)iterfindrtrurvs rroz)prepare_predicate..select_negated"sn"""D!]]3//""771::<<00E99"&JJJ!E:""r$c3tK|D]1}d|kr|V2dSrsrtrur r/r0rls rr3z!prepare_predicate..select)I"##Dwwt}}//588" ##r$c3tK|D]1}d|kr|V2dSrsrzr{s rroz)prepare_predicate..select_negated-r|r$z-()z-()-zXPath position >= 1 expectedlastzunsupported functionr6zunsupported expressionr(z)XPath offset from last() must be negativec3Kt|}|D]W} ||}t||j}||ur|VA#tt f$rYTwxYwdSr)r#listr r IndexErrorr)r r/rr0rbelemsindexs rr3z!prepare_predicate..selectEs'00J  '-F !9!9::EU|t++" "H-D  s=AA*)A*zinvalid predicate)r]appendrtrematchintr ValueError) rNr signature predicater3rorrjrrls @@@@rprepare_predicatersII # DFFEE    FF  8s??  H    8 (a! --q!B$'EqS)))q""" # ""IDl      Fi722l"             "&!2!2~~>CYq\ B Bl      EY&00 %  9#6#6HZ166$7l"   # " " " " " "  " " " " " " " # # # # # # # # # #"&!2!2~~>C9--f1D1D    ! %%)Eqyy!"@AAA|v%%!"8999F""@ ! --1EE!@@@%&>???@2::%&QRRR      ) * **s  $$6HH))rrX.z..z//[ceZdZdZdZdS)_SelectorContextNc||_dSr)r)selfrs r__init__z_SelectorContext.__init__`s  r$)__name__ __module__ __qualname__rrr*r$rrr^s(Jr$rcZ|dddkr|dz}|f}|r1|tt|z } t|}n.#t$r t tdkrt|dddkrtdtt||j } |}n#t$rYYdSwxYwg} | t|d||n#t$rtddwxYw |}|ddkr |}n#t$rYnwxYw|t|<YnwxYw|g}t|}|D]} | ||}|S) Nr:/rXdrz#cannot use absolute path on elementrz invalid path)tuplesorteditems_cacherrAclearrrr__next__r]ropsr) r0pathr cache_keyselectorrNrr/r r3s rrxrxhs  BCCyCczI7U6*"2"2"4"455666 %)$ %%% v;;   LLNNN 8s??CDD DOD*5566? DFFEE    FFF   <E!H dE : :;;;;  < < <!.11t; < 8s?? DFFE      %y-%0VFt$$G))(( Mss AA;F C! F! C0+F/C00F7/D'&F'EF E'&F' E41F3E44FFc@tt|||dSr)rNrxr0rrs rrqrqs tZ00$ 7 77r$c>tt|||Sr)rrxrs rr r s tZ00 1 11r$c tt|||}|jdS|jS#t$r|cYSwxYwrs)rNrxtextr])r0rdefaultrs rfindtextrsYHT44455 9 2y s%00 ??r)NN)rcompiler rr#r,rCrOrSrVr^rcrrrrrxrqr rr*r$rrstv RZ    ----0000&&&R&  >   n+n+n+b        ''''X8888 2222 r$PKN\CfY.etree/__pycache__/cElementTree.cpython-311.pycnu[ !A?hRddlTdS))*N)xml.etree.ElementTreeC/opt/alt/python-internal/lib64/python3.11/xml/etree/cElementTree.pyrs$#####rPKN\W*etree/__pycache__/__init__.cpython-311.pycnu[ !A?hEdS)Nr?/opt/alt/python-internal/lib64/python3.11/xml/etree/__init__.pyrsrPKN\W0etree/__pycache__/__init__.cpython-311.opt-1.pycnu[ !A?hEdS)Nr?/opt/alt/python-internal/lib64/python3.11/xml/etree/__init__.pyrsrPKN\~h@eCeC-etree/__pycache__/ElementPath.cpython-311.pycnu[ !A?h6ddlZejdZddZdZdZdZdZdZd Z d Z d Z d Z eee e e e d Z iZGddZddZddZddZddZdS)Nz`('[^']*'|\"[^\"]*\"|::|//?|\.\.|\(\)|!=|[/.*:\[\]\(\)@=])|((?:\{[^}]+\})?[^/\[\]\(\)@!=\s]+)|\s+c#K|r|dnd}d}t|D]}|\}}|r|ddkrsd|vrW|dd\}} |st|d||d|fVn6#t$rt d|zdwxYw|r|s |d|d|fVn|Vd}|V|d k}dS) NFr{:}z!prefix %r not found in prefix map@)getxpath_tokenizer_refindallsplitKeyError SyntaxError) pattern namespacesdefault_namespaceparsing_attributetokenttypetagprefixuris B/opt/alt/python-internal/lib64/python3.11/xml/etree/ElementPath.pyxpath_tokenizerrJsY.8B r***d#++G44-- s  -3q6S==czz!iiQ// ^%'&%Z-?-?-?!EEEEEE^^^%&IF&RSSY]]^" +< e):):):CC@@@@@@ %  KKK %  %--s +BB%cv|j}|/ix|_}|jD] }|D]}|||< |SN) parent_maprootiter)contextrpes rget_parent_mapr#bs_#J*,,Z""$$ " "A " " ! 1  " c:|dddkp |dddkS)N{*}}*rs r_is_wildcard_tagr,ls' rr7e  /s233x4//r$cttcdkrfd}ndkrfd}ndddkr<ddtt dddfd}nPd dd kr0dd tdtfd }nt d |S)Nz{*}*c3@K|D]}|jr|VdSrr+)r resultelem _isinstance_strs rselectz_prepare_tag..selectvs@  ;tx..JJJ  r$z{}*c3\K|D]%}|j}|r|ddkr|V&dS)Nrrr+)r r/r0el_tagr1r2s rr3z_prepare_tag..select|sS  ;vt,,c1A1AJJJ  r$r&r'c3hK|D]+}|j}|ks|r|kr|V,dSrr+) r r/r0r5r1r2no_nssuffixrs rr3z_prepare_tag..selectsY  S==KK$=$==&-SYBYBYJJJ  r$r(r)c3\K|D]%}|j}|r|kr|V&dSrr+)r r/r0r5r1r2nsns_onlys rr3z_prepare_tag..selectsS  ;vt,,B1F1FJJJ  r$zinternal parser error, got ) isinstancestrslicelen RuntimeError)rr3r1r2r8r<r=r9s` @@@@@@r _prepare_tagrCpsi"CK f}}                RaRE  QRRs6{{lD))!""g           RSST   "Xc"gg&&          >>>??? Mr$c|dtrtfd}ndddkr ddfd}|S)Nrc4d}|||S)Nc3$K|D] }|Ed{V dSrr*)r/r0s r select_childz3prepare_child..select..select_childs2"$$D#OOOOOOOO$$r$r*r r/rG select_tags rr3zprepare_child..selects0 $ $ $:g||F';';<< K|D]}|D]}|jkr|VdSrr+r r/r0r"rs rr3zprepare_child..selectsI    Au||   r$)r,rCnextrr3rIrs @@r prepare_childrOs (C !#&&  = = = = = = rr7d??abb'C     Mr$c d}|S)Nc3$K|D] }|Ed{V dSrr*)r r/r0s rr3zprepare_star..selects2  DOOOOOOOO  r$r*rNrr3s r prepare_starrSs Mr$c d}|S)Nc3K|Ed{VdSrr*)r r/s rr3zprepare_self..selects$r$r*rRs r prepare_selfrVs Mr$c$ |}n#t$rYdSwxYw|ddkrdn |ds |dntdtrtfd}ndddkr ddfd}|S) Nr*rzinvalid descendantc4d}|||S)Nc3RK|D]!}|D] }||ur|V "dSrr)r/r0r"s rrGz8prepare_descendant..select..select_childsN"$$D!YY[[$$D=="#GGG$$$r$r*rHs rr3z"prepare_descendant..selects0 $ $ $ :g||F';';<< .selectsQ  3  A}}   r$) StopIterationrr,rCrMs @@rprepare_descendantr^s  Qx3 1X0Ah./// !#&&  = = = = = = rr7d??abb'C     Ms  c d}|S)Nc3hKt|}i}|D]}||vr||}||vr d||<|VdSr)r#)r r/r result_mapr0parents rr3zprepare_parent..selectse#G,,   ! !Dz!!#D)++)-Jv& LLL  ! !r$r*rRs rprepare_parentrcs ! ! ! Mr$c g}g} |}n#t$rYdSwxYw|ddkrnl|dkr2|dr$|ddddvrd|dddf}||dpd||dd |}|d kr|dfd }|S|d ks|d kr$|d|d  fd} fd}d|vr|n|S|dkr*tjd|ds|dfd}|S|dks-|dks'|dks|dkrLtjd|ds1|d|d r  fd} fd}n fd} fd}d|vr|n|S|dks |dks|dkr|dkr.t |ddz dkrt dnp|ddkrt d|dkrM t |d dz n#t$rt d!wxYwd"krt d#ndfd$}|St d%)&Nrr])rrz'"'r:-rz@-c3HK|D]}||VdSrr )r r/r0keys rr3z!prepare_predicate..selects:  88C==,JJJ  r$z@-='z@-!='c3PK|D]}|kr|V dSrri)r r/r0rjvalues rr3z!prepare_predicate..selects?  88C==E))JJJ  r$c3XK|D]#}|x} |kr|V$dSrri)r r/r0 attr_valuerjrls rselect_negatedz)prepare_predicate..select_negatedsI  "&((3--/J<uATATJJJ  r$z!=z\-?\d+$c3HK|D]}||VdSr)find)r r/r0rs rr3z!prepare_predicate..selects:  99S>>-JJJ  r$z.='z.!='z-='z-!='c3K|D]K}|D]3}d|kr|Vn4LdSNr)r joinitertextr r/r0r"rrls rr3z!prepare_predicate..selectsn"""D!\\#..""771::<<00E99"&JJJ!E:""r$c3K|D]K}|D]3}d|kr|Vn4LdSrs)iterfindrtrurvs rroz)prepare_predicate..select_negated"sn"""D!]]3//""771::<<00E99"&JJJ!E:""r$c3tK|D]1}d|kr|V2dSrsrtrur r/r0rls rr3z!prepare_predicate..select)I"##Dwwt}}//588" ##r$c3tK|D]1}d|kr|V2dSrsrzr{s rroz)prepare_predicate..select_negated-r|r$z-()z-()-zXPath position >= 1 expectedlastzunsupported functionr6zunsupported expressionr(z)XPath offset from last() must be negativec3Kt|}|D]W} ||}t||j}||ur|VA#tt f$rYTwxYwdSr)r#listr r IndexErrorr)r r/rr0rbelemsindexs rr3z!prepare_predicate..selectEs'00J  '-F !9!9::EU|t++" "H-D  s=AA*)A*zinvalid predicate)r]appendrtrematchintr ValueError) rNr signature predicater3rorrjrrls @@@@rprepare_predicatersII # DFFEE    FF  8s??  H    8 (a! --q!B$'EqS)))q""" # ""IDl      Fi722l"             "&!2!2~~>CYq\ B Bl      EY&00 %  9#6#6HZ166$7l"   # " " " " " "  " " " " " " " # # # # # # # # # #"&!2!2~~>C9--f1D1D    ! %%)Eqyy!"@AAA|v%%!"8999F""@ ! --1EE!@@@%&>???@2::%&QRRR      ) * **s  $$6HH))rrX.z..z//[ceZdZdZdZdS)_SelectorContextNc||_dSr)r)selfrs r__init__z_SelectorContext.__init__`s  r$)__name__ __module__ __qualname__rrr*r$rrr^s(Jr$rcZ|dddkr|dz}|f}|r1|tt|z } t|}n.#t$r t tdkrt|dddkrtdtt||j } |}n#t$rYYdSwxYwg} | t|d||n#t$rtddwxYw |}|ddkr |}n#t$rYnwxYw|t|<YnwxYw|g}t|}|D]} | ||}|S) Nr:/rXdrz#cannot use absolute path on elementrz invalid path)tuplesorteditems_cacherrAclearrrr__next__r]ropsr) r0pathr cache_keyselectorrNrr/r r3s rrxrxhs  BCCyCczI7U6*"2"2"4"455666 %)$ %%% v;;   LLNNN 8s??CDD DOD*5566? DFFEE    FFF   <E!H dE : :;;;;  < < <!.11t; < 8s?? DFFE      %y-%0VFt$$G))(( Mss AA;F C! F! C0+F/C00F7/D'&F'EF E'&F' E41F3E44FFc@tt|||dSr)rNrxr0rrs rrqrqs tZ00$ 7 77r$c>tt|||Sr)rrxrs rr r s tZ00 1 11r$c tt|||}|jdS|jS#t$r|cYSwxYwrs)rNrxtextr])r0rdefaultrs rfindtextrsYHT44455 9 2y s%00 ??r)NN)rcompiler rr#r,rCrOrSrVr^rcrrrrrxrqr rr*r$rrstv RZ    ----0000&&&R&  >   n+n+n+b        ''''X8888 2222 r$PKN\q66etree/ElementPath.pynu[# # ElementTree # $Id: ElementPath.py 3375 2008-02-13 08:05:08Z fredrik $ # # limited xpath support for element trees # # history: # 2003-05-23 fl created # 2003-05-28 fl added support for // etc # 2003-08-27 fl fixed parsing of periods in element names # 2007-09-10 fl new selection engine # 2007-09-12 fl fixed parent selector # 2007-09-13 fl added iterfind; changed findall to return a list # 2007-11-30 fl added namespaces support # 2009-10-30 fl added child element value filter # # Copyright (c) 2003-2009 by Fredrik Lundh. All rights reserved. # # fredrik@pythonware.com # http://www.pythonware.com # # -------------------------------------------------------------------- # The ElementTree toolkit is # # Copyright (c) 1999-2009 by Fredrik Lundh # # By obtaining, using, and/or copying this software and/or its # associated documentation, you agree that you have read, understood, # and will comply with the following terms and conditions: # # Permission to use, copy, modify, and distribute this software and # its associated documentation for any purpose and without fee is # hereby granted, provided that the above copyright notice appears in # all copies, and that both that copyright notice and this permission # notice appear in supporting documentation, and that the name of # Secret Labs AB or the author not be used in advertising or publicity # pertaining to distribution of the software without specific, written # prior permission. # # SECRET LABS AB AND THE AUTHOR DISCLAIMS ALL WARRANTIES WITH REGARD # TO THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANT- # ABILITY AND FITNESS. IN NO EVENT SHALL SECRET LABS AB OR THE AUTHOR # BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY # DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, # WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS # ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE # OF THIS SOFTWARE. # -------------------------------------------------------------------- # Licensed to PSF under a Contributor Agreement. # See https://www.python.org/psf/license for licensing details. ## # Implementation module for XPath support. There's usually no reason # to import this module directly; the ElementTree does this for # you, if needed. ## import re xpath_tokenizer_re = re.compile( r"(" r"'[^']*'|\"[^\"]*\"|" r"::|" r"//?|" r"\.\.|" r"\(\)|" r"!=|" r"[/.*:\[\]\(\)@=])|" r"((?:\{[^}]+\})?[^/\[\]\(\)@!=\s]+)|" r"\s+" ) def xpath_tokenizer(pattern, namespaces=None): default_namespace = namespaces.get('') if namespaces else None parsing_attribute = False for token in xpath_tokenizer_re.findall(pattern): ttype, tag = token if tag and tag[0] != "{": if ":" in tag: prefix, uri = tag.split(":", 1) try: if not namespaces: raise KeyError yield ttype, "{%s}%s" % (namespaces[prefix], uri) except KeyError: raise SyntaxError("prefix %r not found in prefix map" % prefix) from None elif default_namespace and not parsing_attribute: yield ttype, "{%s}%s" % (default_namespace, tag) else: yield token parsing_attribute = False else: yield token parsing_attribute = ttype == '@' def get_parent_map(context): parent_map = context.parent_map if parent_map is None: context.parent_map = parent_map = {} for p in context.root.iter(): for e in p: parent_map[e] = p return parent_map def _is_wildcard_tag(tag): return tag[:3] == '{*}' or tag[-2:] == '}*' def _prepare_tag(tag): _isinstance, _str = isinstance, str if tag == '{*}*': # Same as '*', but no comments or processing instructions. # It can be a surprise that '*' includes those, but there is no # justification for '{*}*' doing the same. def select(context, result): for elem in result: if _isinstance(elem.tag, _str): yield elem elif tag == '{}*': # Any tag that is not in a namespace. def select(context, result): for elem in result: el_tag = elem.tag if _isinstance(el_tag, _str) and el_tag[0] != '{': yield elem elif tag[:3] == '{*}': # The tag in any (or no) namespace. suffix = tag[2:] # '}name' no_ns = slice(-len(suffix), None) tag = tag[3:] def select(context, result): for elem in result: el_tag = elem.tag if el_tag == tag or _isinstance(el_tag, _str) and el_tag[no_ns] == suffix: yield elem elif tag[-2:] == '}*': # Any tag in the given namespace. ns = tag[:-1] ns_only = slice(None, len(ns)) def select(context, result): for elem in result: el_tag = elem.tag if _isinstance(el_tag, _str) and el_tag[ns_only] == ns: yield elem else: raise RuntimeError(f"internal parser error, got {tag}") return select def prepare_child(next, token): tag = token[1] if _is_wildcard_tag(tag): select_tag = _prepare_tag(tag) def select(context, result): def select_child(result): for elem in result: yield from elem return select_tag(context, select_child(result)) else: if tag[:2] == '{}': tag = tag[2:] # '{}tag' == 'tag' def select(context, result): for elem in result: for e in elem: if e.tag == tag: yield e return select def prepare_star(next, token): def select(context, result): for elem in result: yield from elem return select def prepare_self(next, token): def select(context, result): yield from result return select def prepare_descendant(next, token): try: token = next() except StopIteration: return if token[0] == "*": tag = "*" elif not token[0]: tag = token[1] else: raise SyntaxError("invalid descendant") if _is_wildcard_tag(tag): select_tag = _prepare_tag(tag) def select(context, result): def select_child(result): for elem in result: for e in elem.iter(): if e is not elem: yield e return select_tag(context, select_child(result)) else: if tag[:2] == '{}': tag = tag[2:] # '{}tag' == 'tag' def select(context, result): for elem in result: for e in elem.iter(tag): if e is not elem: yield e return select def prepare_parent(next, token): def select(context, result): # FIXME: raise error if .. is applied at toplevel? parent_map = get_parent_map(context) result_map = {} for elem in result: if elem in parent_map: parent = parent_map[elem] if parent not in result_map: result_map[parent] = None yield parent return select def prepare_predicate(next, token): # FIXME: replace with real parser!!! refs: # http://javascript.crockford.com/tdop/tdop.html signature = [] predicate = [] while 1: try: token = next() except StopIteration: return if token[0] == "]": break if token == ('', ''): # ignore whitespace continue if token[0] and token[0][:1] in "'\"": token = "'", token[0][1:-1] signature.append(token[0] or "-") predicate.append(token[1]) signature = "".join(signature) # use signature to determine predicate type if signature == "@-": # [@attribute] predicate key = predicate[1] def select(context, result): for elem in result: if elem.get(key) is not None: yield elem return select if signature == "@-='" or signature == "@-!='": # [@attribute='value'] or [@attribute!='value'] key = predicate[1] value = predicate[-1] def select(context, result): for elem in result: if elem.get(key) == value: yield elem def select_negated(context, result): for elem in result: if (attr_value := elem.get(key)) is not None and attr_value != value: yield elem return select_negated if '!=' in signature else select if signature == "-" and not re.match(r"\-?\d+$", predicate[0]): # [tag] tag = predicate[0] def select(context, result): for elem in result: if elem.find(tag) is not None: yield elem return select if signature == ".='" or signature == ".!='" or ( (signature == "-='" or signature == "-!='") and not re.match(r"\-?\d+$", predicate[0])): # [.='value'] or [tag='value'] or [.!='value'] or [tag!='value'] tag = predicate[0] value = predicate[-1] if tag: def select(context, result): for elem in result: for e in elem.findall(tag): if "".join(e.itertext()) == value: yield elem break def select_negated(context, result): for elem in result: for e in elem.iterfind(tag): if "".join(e.itertext()) != value: yield elem break else: def select(context, result): for elem in result: if "".join(elem.itertext()) == value: yield elem def select_negated(context, result): for elem in result: if "".join(elem.itertext()) != value: yield elem return select_negated if '!=' in signature else select if signature == "-" or signature == "-()" or signature == "-()-": # [index] or [last()] or [last()-index] if signature == "-": # [index] index = int(predicate[0]) - 1 if index < 0: raise SyntaxError("XPath position >= 1 expected") else: if predicate[0] != "last": raise SyntaxError("unsupported function") if signature == "-()-": try: index = int(predicate[2]) - 1 except ValueError: raise SyntaxError("unsupported expression") if index > -2: raise SyntaxError("XPath offset from last() must be negative") else: index = -1 def select(context, result): parent_map = get_parent_map(context) for elem in result: try: parent = parent_map[elem] # FIXME: what if the selector is "*" ? elems = list(parent.findall(elem.tag)) if elems[index] is elem: yield elem except (IndexError, KeyError): pass return select raise SyntaxError("invalid predicate") ops = { "": prepare_child, "*": prepare_star, ".": prepare_self, "..": prepare_parent, "//": prepare_descendant, "[": prepare_predicate, } _cache = {} class _SelectorContext: parent_map = None def __init__(self, root): self.root = root # -------------------------------------------------------------------- ## # Generate all matching objects. def iterfind(elem, path, namespaces=None): # compile selector pattern if path[-1:] == "/": path = path + "*" # implicit all (FIXME: keep this?) cache_key = (path,) if namespaces: cache_key += tuple(sorted(namespaces.items())) try: selector = _cache[cache_key] except KeyError: if len(_cache) > 100: _cache.clear() if path[:1] == "/": raise SyntaxError("cannot use absolute path on element") next = iter(xpath_tokenizer(path, namespaces)).__next__ try: token = next() except StopIteration: return selector = [] while 1: try: selector.append(ops[token[0]](next, token)) except StopIteration: raise SyntaxError("invalid path") from None try: token = next() if token[0] == "/": token = next() except StopIteration: break _cache[cache_key] = selector # execute selector pattern result = [elem] context = _SelectorContext(elem) for select in selector: result = select(context, result) return result ## # Find first matching object. def find(elem, path, namespaces=None): return next(iterfind(elem, path, namespaces), None) ## # Find all matching objects. def findall(elem, path, namespaces=None): return list(iterfind(elem, path, namespaces)) ## # Find text for first matching object. def findtext(elem, path, default=None, namespaces=None): try: elem = next(iterfind(elem, path, namespaces)) if elem.text is None: return "" return elem.text except StopIteration: return default PKN\ha""etree/ElementTree.pynu["""Lightweight XML support for Python. XML is an inherently hierarchical data format, and the most natural way to represent it is with a tree. This module has two classes for this purpose: 1. ElementTree represents the whole XML document as a tree and 2. Element represents a single node in this tree. Interactions with the whole document (reading and writing to/from files) are usually done on the ElementTree level. Interactions with a single XML element and its sub-elements are done on the Element level. Element is a flexible container object designed to store hierarchical data structures in memory. It can be described as a cross between a list and a dictionary. Each Element has a number of properties associated with it: 'tag' - a string containing the element's name. 'attributes' - a Python dictionary storing the element's attributes. 'text' - a string containing the element's text content. 'tail' - an optional string containing text after the element's end tag. And a number of child elements stored in a Python sequence. To create an element instance, use the Element constructor, or the SubElement factory function. You can also use the ElementTree class to wrap an element structure and convert it to and from XML. """ #--------------------------------------------------------------------- # Licensed to PSF under a Contributor Agreement. # See https://www.python.org/psf/license for licensing details. # # ElementTree # Copyright (c) 1999-2008 by Fredrik Lundh. All rights reserved. # # fredrik@pythonware.com # http://www.pythonware.com # -------------------------------------------------------------------- # The ElementTree toolkit is # # Copyright (c) 1999-2008 by Fredrik Lundh # # By obtaining, using, and/or copying this software and/or its # associated documentation, you agree that you have read, understood, # and will comply with the following terms and conditions: # # Permission to use, copy, modify, and distribute this software and # its associated documentation for any purpose and without fee is # hereby granted, provided that the above copyright notice appears in # all copies, and that both that copyright notice and this permission # notice appear in supporting documentation, and that the name of # Secret Labs AB or the author not be used in advertising or publicity # pertaining to distribution of the software without specific, written # prior permission. # # SECRET LABS AB AND THE AUTHOR DISCLAIMS ALL WARRANTIES WITH REGARD # TO THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANT- # ABILITY AND FITNESS. IN NO EVENT SHALL SECRET LABS AB OR THE AUTHOR # BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY # DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, # WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS # ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE # OF THIS SOFTWARE. # -------------------------------------------------------------------- __all__ = [ # public symbols "Comment", "dump", "Element", "ElementTree", "fromstring", "fromstringlist", "indent", "iselement", "iterparse", "parse", "ParseError", "PI", "ProcessingInstruction", "QName", "SubElement", "tostring", "tostringlist", "TreeBuilder", "VERSION", "XML", "XMLID", "XMLParser", "XMLPullParser", "register_namespace", "canonicalize", "C14NWriterTarget", ] VERSION = "1.3.0" import sys import re import warnings import io import collections import collections.abc import contextlib import weakref from . import ElementPath class ParseError(SyntaxError): """An error when parsing an XML document. In addition to its exception value, a ParseError contains two extra attributes: 'code' - the specific exception code 'position' - the line and column of the error """ pass # -------------------------------------------------------------------- def iselement(element): """Return True if *element* appears to be an Element.""" return hasattr(element, 'tag') class Element: """An XML element. This class is the reference implementation of the Element interface. An element's length is its number of subelements. That means if you want to check if an element is truly empty, you should check BOTH its length AND its text attribute. The element tag, attribute names, and attribute values can be either bytes or strings. *tag* is the element name. *attrib* is an optional dictionary containing element attributes. *extra* are additional element attributes given as keyword arguments. Example form: text...tail """ tag = None """The element's name.""" attrib = None """Dictionary of the element's attributes.""" text = None """ Text before first subelement. This is either a string or the value None. Note that if there is no text, this attribute may be either None or the empty string, depending on the parser. """ tail = None """ Text after this element's end tag, but before the next sibling element's start tag. This is either a string or the value None. Note that if there was no text, this attribute may be either None or an empty string, depending on the parser. """ def __init__(self, tag, attrib={}, **extra): if not isinstance(attrib, dict): raise TypeError("attrib must be dict, not %s" % ( attrib.__class__.__name__,)) self.tag = tag self.attrib = {**attrib, **extra} self._children = [] def __repr__(self): return "<%s %r at %#x>" % (self.__class__.__name__, self.tag, id(self)) def makeelement(self, tag, attrib): """Create a new element with the same type. *tag* is a string containing the element name. *attrib* is a dictionary containing the element attributes. Do not call this method, use the SubElement factory function instead. """ return self.__class__(tag, attrib) def copy(self): """Return copy of current element. This creates a shallow copy. Subelements will be shared with the original tree. """ warnings.warn( "elem.copy() is deprecated. Use copy.copy(elem) instead.", DeprecationWarning ) return self.__copy__() def __copy__(self): elem = self.makeelement(self.tag, self.attrib) elem.text = self.text elem.tail = self.tail elem[:] = self return elem def __len__(self): return len(self._children) def __bool__(self): warnings.warn( "The behavior of this method will change in future versions. " "Use specific 'len(elem)' or 'elem is not None' test instead.", FutureWarning, stacklevel=2 ) return len(self._children) != 0 # emulate old behaviour, for now def __getitem__(self, index): return self._children[index] def __setitem__(self, index, element): if isinstance(index, slice): for elt in element: self._assert_is_element(elt) else: self._assert_is_element(element) self._children[index] = element def __delitem__(self, index): del self._children[index] def append(self, subelement): """Add *subelement* to the end of this element. The new element will appear in document order after the last existing subelement (or directly after the text, if it's the first subelement), but before the end tag for this element. """ self._assert_is_element(subelement) self._children.append(subelement) def extend(self, elements): """Append subelements from a sequence. *elements* is a sequence with zero or more elements. """ for element in elements: self._assert_is_element(element) self._children.append(element) def insert(self, index, subelement): """Insert *subelement* at position *index*.""" self._assert_is_element(subelement) self._children.insert(index, subelement) def _assert_is_element(self, e): # Need to refer to the actual Python implementation, not the # shadowing C implementation. if not isinstance(e, _Element_Py): raise TypeError('expected an Element, not %s' % type(e).__name__) def remove(self, subelement): """Remove matching subelement. Unlike the find methods, this method compares elements based on identity, NOT ON tag value or contents. To remove subelements by other means, the easiest way is to use a list comprehension to select what elements to keep, and then use slice assignment to update the parent element. ValueError is raised if a matching element could not be found. """ # assert iselement(element) self._children.remove(subelement) def find(self, path, namespaces=None): """Find first matching element by tag name or path. *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. """ return ElementPath.find(self, path, namespaces) def findtext(self, path, default=None, namespaces=None): """Find text for first matching element by tag name or path. *path* is a string having either an element tag or an XPath, *default* is the value to return if the element was not found, *namespaces* is an optional mapping from namespace prefix to full name. Return text content of first matching element, or default value if none was found. Note that if an element is found having no text content, the empty string is returned. """ return ElementPath.findtext(self, path, default, namespaces) def findall(self, path, namespaces=None): """Find all matching subelements by tag name or path. *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Returns list containing all matching elements in document order. """ return ElementPath.findall(self, path, namespaces) def iterfind(self, path, namespaces=None): """Find all matching subelements by tag name or path. *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return an iterable yielding all matching elements in document order. """ return ElementPath.iterfind(self, path, namespaces) def clear(self): """Reset element. This function removes all subelements, clears all attributes, and sets the text and tail attributes to None. """ self.attrib.clear() self._children = [] self.text = self.tail = None def get(self, key, default=None): """Get element attribute. Equivalent to attrib.get, but some implementations may handle this a bit more efficiently. *key* is what attribute to look for, and *default* is what to return if the attribute was not found. Returns a string containing the attribute value, or the default if attribute was not found. """ return self.attrib.get(key, default) def set(self, key, value): """Set element attribute. Equivalent to attrib[key] = value, but some implementations may handle this a bit more efficiently. *key* is what attribute to set, and *value* is the attribute value to set it to. """ self.attrib[key] = value def keys(self): """Get list of attribute names. Names are returned in an arbitrary order, just like an ordinary Python dict. Equivalent to attrib.keys() """ return self.attrib.keys() def items(self): """Get element attributes as a sequence. The attributes are returned in arbitrary order. Equivalent to attrib.items(). Return a list of (name, value) tuples. """ return self.attrib.items() def iter(self, tag=None): """Create tree iterator. The iterator loops over the element and all subelements in document order, returning all elements with a matching tag. If the tree structure is modified during iteration, new or removed elements may or may not be included. To get a stable set, use the list() function on the iterator, and loop over the resulting list. *tag* is what tags to look for (default is to return all elements) Return an iterator containing all the matching elements. """ if tag == "*": tag = None if tag is None or self.tag == tag: yield self for e in self._children: yield from e.iter(tag) def itertext(self): """Create text iterator. The iterator loops over the element and all subelements in document order, returning all inner text. """ tag = self.tag if not isinstance(tag, str) and tag is not None: return t = self.text if t: yield t for e in self: yield from e.itertext() t = e.tail if t: yield t def SubElement(parent, tag, attrib={}, **extra): """Subelement factory which creates an element instance, and appends it to an existing parent. The element tag, attribute names, and attribute values can be either bytes or Unicode strings. *parent* is the parent element, *tag* is the subelements name, *attrib* is an optional directory containing element attributes, *extra* are additional attributes given as keyword arguments. """ attrib = {**attrib, **extra} element = parent.makeelement(tag, attrib) parent.append(element) return element def Comment(text=None): """Comment element factory. This function creates a special element which the standard serializer serializes as an XML comment. *text* is a string containing the comment string. """ element = Element(Comment) element.text = text return element def ProcessingInstruction(target, text=None): """Processing Instruction element factory. This function creates a special element which the standard serializer serializes as an XML comment. *target* is a string containing the processing instruction, *text* is a string containing the processing instruction contents, if any. """ element = Element(ProcessingInstruction) element.text = target if text: element.text = element.text + " " + text return element PI = ProcessingInstruction class QName: """Qualified name wrapper. This class can be used to wrap a QName attribute value in order to get proper namespace handing on output. *text_or_uri* is a string containing the QName value either in the form {uri}local, or if the tag argument is given, the URI part of a QName. *tag* is an optional argument which if given, will make the first argument (text_or_uri) be interpreted as a URI, and this argument (tag) be interpreted as a local name. """ def __init__(self, text_or_uri, tag=None): if tag: text_or_uri = "{%s}%s" % (text_or_uri, tag) self.text = text_or_uri def __str__(self): return self.text def __repr__(self): return '<%s %r>' % (self.__class__.__name__, self.text) def __hash__(self): return hash(self.text) def __le__(self, other): if isinstance(other, QName): return self.text <= other.text return self.text <= other def __lt__(self, other): if isinstance(other, QName): return self.text < other.text return self.text < other def __ge__(self, other): if isinstance(other, QName): return self.text >= other.text return self.text >= other def __gt__(self, other): if isinstance(other, QName): return self.text > other.text return self.text > other def __eq__(self, other): if isinstance(other, QName): return self.text == other.text return self.text == other # -------------------------------------------------------------------- class ElementTree: """An XML element hierarchy. This class also provides support for serialization to and from standard XML. *element* is an optional root element node, *file* is an optional file handle or file name of an XML file whose contents will be used to initialize the tree with. """ def __init__(self, element=None, file=None): # assert element is None or iselement(element) self._root = element # first node if file: self.parse(file) def getroot(self): """Return root element of this tree.""" return self._root def _setroot(self, element): """Replace root element of this tree. This will discard the current contents of the tree and replace it with the given element. Use with care! """ # assert iselement(element) self._root = element def parse(self, source, parser=None): """Load external XML document into element tree. *source* is a file name or file object, *parser* is an optional parser instance that defaults to XMLParser. ParseError is raised if the parser fails to parse the document. Returns the root element of the given source document. """ close_source = False if not hasattr(source, "read"): source = open(source, "rb") close_source = True try: if parser is None: # If no parser was specified, create a default XMLParser parser = XMLParser() if hasattr(parser, '_parse_whole'): # The default XMLParser, when it comes from an accelerator, # can define an internal _parse_whole API for efficiency. # It can be used to parse the whole source without feeding # it with chunks. self._root = parser._parse_whole(source) return self._root while True: data = source.read(65536) if not data: break parser.feed(data) self._root = parser.close() return self._root finally: if close_source: source.close() def iter(self, tag=None): """Create and return tree iterator for the root element. The iterator loops over all elements in this tree, in document order. *tag* is a string with the tag name to iterate over (default is to return all elements). """ # assert self._root is not None return self._root.iter(tag) def find(self, path, namespaces=None): """Find first matching element by tag name or path. Same as getroot().find(path), which is Element.find() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. """ # assert self._root is not None if path[:1] == "/": path = "." + path warnings.warn( "This search is broken in 1.3 and earlier, and will be " "fixed in a future version. If you rely on the current " "behaviour, change it to %r" % path, FutureWarning, stacklevel=2 ) return self._root.find(path, namespaces) def findtext(self, path, default=None, namespaces=None): """Find first matching element by tag name or path. Same as getroot().findtext(path), which is Element.findtext() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return the first matching element, or None if no element was found. """ # assert self._root is not None if path[:1] == "/": path = "." + path warnings.warn( "This search is broken in 1.3 and earlier, and will be " "fixed in a future version. If you rely on the current " "behaviour, change it to %r" % path, FutureWarning, stacklevel=2 ) return self._root.findtext(path, default, namespaces) def findall(self, path, namespaces=None): """Find all matching subelements by tag name or path. Same as getroot().findall(path), which is Element.findall(). *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return list containing all matching elements in document order. """ # assert self._root is not None if path[:1] == "/": path = "." + path warnings.warn( "This search is broken in 1.3 and earlier, and will be " "fixed in a future version. If you rely on the current " "behaviour, change it to %r" % path, FutureWarning, stacklevel=2 ) return self._root.findall(path, namespaces) def iterfind(self, path, namespaces=None): """Find all matching subelements by tag name or path. Same as getroot().iterfind(path), which is element.iterfind() *path* is a string having either an element tag or an XPath, *namespaces* is an optional mapping from namespace prefix to full name. Return an iterable yielding all matching elements in document order. """ # assert self._root is not None if path[:1] == "/": path = "." + path warnings.warn( "This search is broken in 1.3 and earlier, and will be " "fixed in a future version. If you rely on the current " "behaviour, change it to %r" % path, FutureWarning, stacklevel=2 ) return self._root.iterfind(path, namespaces) def write(self, file_or_filename, encoding=None, xml_declaration=None, default_namespace=None, method=None, *, short_empty_elements=True): """Write element tree to a file as XML. Arguments: *file_or_filename* -- file name or a file object opened for writing *encoding* -- the output encoding (default: US-ASCII) *xml_declaration* -- bool indicating if an XML declaration should be added to the output. If None, an XML declaration is added if encoding IS NOT either of: US-ASCII, UTF-8, or Unicode *default_namespace* -- sets the default XML namespace (for "xmlns") *method* -- either "xml" (default), "html, "text", or "c14n" *short_empty_elements* -- controls the formatting of elements that contain no content. If True (default) they are emitted as a single self-closed tag, otherwise they are emitted as a pair of start/end tags """ if not method: method = "xml" elif method not in _serialize: raise ValueError("unknown method %r" % method) if not encoding: if method == "c14n": encoding = "utf-8" else: encoding = "us-ascii" with _get_writer(file_or_filename, encoding) as (write, declared_encoding): if method == "xml" and (xml_declaration or (xml_declaration is None and encoding.lower() != "unicode" and declared_encoding.lower() not in ("utf-8", "us-ascii"))): write("\n" % ( declared_encoding,)) if method == "text": _serialize_text(write, self._root) else: qnames, namespaces = _namespaces(self._root, default_namespace) serialize = _serialize[method] serialize(write, self._root, qnames, namespaces, short_empty_elements=short_empty_elements) def write_c14n(self, file): # lxml.etree compatibility. use output method instead return self.write(file, method="c14n") # -------------------------------------------------------------------- # serialization support @contextlib.contextmanager def _get_writer(file_or_filename, encoding): # returns text write method and release all resources after using try: write = file_or_filename.write except AttributeError: # file_or_filename is a file name if encoding.lower() == "unicode": encoding="utf-8" with open(file_or_filename, "w", encoding=encoding, errors="xmlcharrefreplace") as file: yield file.write, encoding else: # file_or_filename is a file-like object # encoding determines if it is a text or binary writer if encoding.lower() == "unicode": # use a text writer as is yield write, getattr(file_or_filename, "encoding", None) or "utf-8" else: # wrap a binary writer with TextIOWrapper with contextlib.ExitStack() as stack: if isinstance(file_or_filename, io.BufferedIOBase): file = file_or_filename elif isinstance(file_or_filename, io.RawIOBase): file = io.BufferedWriter(file_or_filename) # Keep the original file open when the BufferedWriter is # destroyed stack.callback(file.detach) else: # This is to handle passed objects that aren't in the # IOBase hierarchy, but just have a write method file = io.BufferedIOBase() file.writable = lambda: True file.write = write try: # TextIOWrapper uses this methods to determine # if BOM (for UTF-16, etc) should be added file.seekable = file_or_filename.seekable file.tell = file_or_filename.tell except AttributeError: pass file = io.TextIOWrapper(file, encoding=encoding, errors="xmlcharrefreplace", newline="\n") # Keep the original file open when the TextIOWrapper is # destroyed stack.callback(file.detach) yield file.write, encoding def _namespaces(elem, default_namespace=None): # identify namespaces used in this tree # maps qnames to *encoded* prefix:local names qnames = {None: None} # maps uri:s to prefixes namespaces = {} if default_namespace: namespaces[default_namespace] = "" def add_qname(qname): # calculate serialized qname representation try: if qname[:1] == "{": uri, tag = qname[1:].rsplit("}", 1) prefix = namespaces.get(uri) if prefix is None: prefix = _namespace_map.get(uri) if prefix is None: prefix = "ns%d" % len(namespaces) if prefix != "xml": namespaces[uri] = prefix if prefix: qnames[qname] = "%s:%s" % (prefix, tag) else: qnames[qname] = tag # default element else: if default_namespace: # FIXME: can this be handled in XML 1.0? raise ValueError( "cannot use non-qualified names with " "default_namespace option" ) qnames[qname] = qname except TypeError: _raise_serialization_error(qname) # populate qname and namespaces table for elem in elem.iter(): tag = elem.tag if isinstance(tag, QName): if tag.text not in qnames: add_qname(tag.text) elif isinstance(tag, str): if tag not in qnames: add_qname(tag) elif tag is not None and tag is not Comment and tag is not PI: _raise_serialization_error(tag) for key, value in elem.items(): if isinstance(key, QName): key = key.text if key not in qnames: add_qname(key) if isinstance(value, QName) and value.text not in qnames: add_qname(value.text) text = elem.text if isinstance(text, QName) and text.text not in qnames: add_qname(text.text) return qnames, namespaces def _serialize_xml(write, elem, qnames, namespaces, short_empty_elements, **kwargs): tag = elem.tag text = elem.text if tag is Comment: write("" % text) elif tag is ProcessingInstruction: write("" % text) else: tag = qnames[tag] if tag is None: if text: write(_escape_cdata(text)) for e in elem: _serialize_xml(write, e, qnames, None, short_empty_elements=short_empty_elements) else: write("<" + tag) items = list(elem.items()) if items or namespaces: if namespaces: for v, k in sorted(namespaces.items(), key=lambda x: x[1]): # sort on prefix if k: k = ":" + k write(" xmlns%s=\"%s\"" % ( k, _escape_attrib(v) )) for k, v in items: if isinstance(k, QName): k = k.text if isinstance(v, QName): v = qnames[v.text] else: v = _escape_attrib(v) write(" %s=\"%s\"" % (qnames[k], v)) if text or len(elem) or not short_empty_elements: write(">") if text: write(_escape_cdata(text)) for e in elem: _serialize_xml(write, e, qnames, None, short_empty_elements=short_empty_elements) write("") else: write(" />") if elem.tail: write(_escape_cdata(elem.tail)) HTML_EMPTY = {"area", "base", "basefont", "br", "col", "embed", "frame", "hr", "img", "input", "isindex", "link", "meta", "param", "source", "track", "wbr"} def _serialize_html(write, elem, qnames, namespaces, **kwargs): tag = elem.tag text = elem.text if tag is Comment: write("" % _escape_cdata(text)) elif tag is ProcessingInstruction: write("" % _escape_cdata(text)) else: tag = qnames[tag] if tag is None: if text: write(_escape_cdata(text)) for e in elem: _serialize_html(write, e, qnames, None) else: write("<" + tag) items = list(elem.items()) if items or namespaces: if namespaces: for v, k in sorted(namespaces.items(), key=lambda x: x[1]): # sort on prefix if k: k = ":" + k write(" xmlns%s=\"%s\"" % ( k, _escape_attrib(v) )) for k, v in items: if isinstance(k, QName): k = k.text if isinstance(v, QName): v = qnames[v.text] else: v = _escape_attrib_html(v) # FIXME: handle boolean attributes write(" %s=\"%s\"" % (qnames[k], v)) write(">") ltag = tag.lower() if text: if ltag == "script" or ltag == "style": write(text) else: write(_escape_cdata(text)) for e in elem: _serialize_html(write, e, qnames, None) if ltag not in HTML_EMPTY: write("") if elem.tail: write(_escape_cdata(elem.tail)) def _serialize_text(write, elem): for part in elem.itertext(): write(part) if elem.tail: write(elem.tail) _serialize = { "xml": _serialize_xml, "html": _serialize_html, "text": _serialize_text, # this optional method is imported at the end of the module # "c14n": _serialize_c14n, } def register_namespace(prefix, uri): """Register a namespace prefix. The registry is global, and any existing mapping for either the given prefix or the namespace URI will be removed. *prefix* is the namespace prefix, *uri* is a namespace uri. Tags and attributes in this namespace will be serialized with prefix if possible. ValueError is raised if prefix is reserved or is invalid. """ if re.match(r"ns\d+$", prefix): raise ValueError("Prefix format reserved for internal use") for k, v in list(_namespace_map.items()): if k == uri or v == prefix: del _namespace_map[k] _namespace_map[uri] = prefix _namespace_map = { # "well-known" namespace prefixes "http://www.w3.org/XML/1998/namespace": "xml", "http://www.w3.org/1999/xhtml": "html", "http://www.w3.org/1999/02/22-rdf-syntax-ns#": "rdf", "http://schemas.xmlsoap.org/wsdl/": "wsdl", # xml schema "http://www.w3.org/2001/XMLSchema": "xs", "http://www.w3.org/2001/XMLSchema-instance": "xsi", # dublin core "http://purl.org/dc/elements/1.1/": "dc", } # For tests and troubleshooting register_namespace._namespace_map = _namespace_map def _raise_serialization_error(text): raise TypeError( "cannot serialize %r (type %s)" % (text, type(text).__name__) ) def _escape_cdata(text): # escape character data try: # it's worth avoiding do-nothing calls for strings that are # shorter than 500 characters, or so. assume that's, by far, # the most common case in most applications. if "&" in text: text = text.replace("&", "&") if "<" in text: text = text.replace("<", "<") if ">" in text: text = text.replace(">", ">") return text except (TypeError, AttributeError): _raise_serialization_error(text) def _escape_attrib(text): # escape attribute value try: if "&" in text: text = text.replace("&", "&") if "<" in text: text = text.replace("<", "<") if ">" in text: text = text.replace(">", ">") if "\"" in text: text = text.replace("\"", """) # Although section 2.11 of the XML specification states that CR or # CR LN should be replaced with just LN, it applies only to EOLNs # which take part of organizing file into lines. Within attributes, # we are replacing these with entity numbers, so they do not count. # http://www.w3.org/TR/REC-xml/#sec-line-ends # The current solution, contained in following six lines, was # discussed in issue 17582 and 39011. if "\r" in text: text = text.replace("\r", " ") if "\n" in text: text = text.replace("\n", " ") if "\t" in text: text = text.replace("\t", " ") return text except (TypeError, AttributeError): _raise_serialization_error(text) def _escape_attrib_html(text): # escape attribute value try: if "&" in text: text = text.replace("&", "&") if ">" in text: text = text.replace(">", ">") if "\"" in text: text = text.replace("\"", """) return text except (TypeError, AttributeError): _raise_serialization_error(text) # -------------------------------------------------------------------- def tostring(element, encoding=None, method=None, *, xml_declaration=None, default_namespace=None, short_empty_elements=True): """Generate string representation of XML element. All subelements are included. If encoding is "unicode", a string is returned. Otherwise a bytestring is returned. *element* is an Element instance, *encoding* is an optional output encoding defaulting to US-ASCII, *method* is an optional output which can be one of "xml" (default), "html", "text" or "c14n", *default_namespace* sets the default XML namespace (for "xmlns"). Returns an (optionally) encoded string containing the XML data. """ stream = io.StringIO() if encoding == 'unicode' else io.BytesIO() ElementTree(element).write(stream, encoding, xml_declaration=xml_declaration, default_namespace=default_namespace, method=method, short_empty_elements=short_empty_elements) return stream.getvalue() class _ListDataStream(io.BufferedIOBase): """An auxiliary stream accumulating into a list reference.""" def __init__(self, lst): self.lst = lst def writable(self): return True def seekable(self): return True def write(self, b): self.lst.append(b) def tell(self): return len(self.lst) def tostringlist(element, encoding=None, method=None, *, xml_declaration=None, default_namespace=None, short_empty_elements=True): lst = [] stream = _ListDataStream(lst) ElementTree(element).write(stream, encoding, xml_declaration=xml_declaration, default_namespace=default_namespace, method=method, short_empty_elements=short_empty_elements) return lst def dump(elem): """Write element tree or element structure to sys.stdout. This function should be used for debugging only. *elem* is either an ElementTree, or a single Element. The exact output format is implementation dependent. In this version, it's written as an ordinary XML file. """ # debugging if not isinstance(elem, ElementTree): elem = ElementTree(elem) elem.write(sys.stdout, encoding="unicode") tail = elem.getroot().tail if not tail or tail[-1] != "\n": sys.stdout.write("\n") def indent(tree, space=" ", level=0): """Indent an XML document by inserting newlines and indentation space after elements. *tree* is the ElementTree or Element to modify. The (root) element itself will not be changed, but the tail text of all elements in its subtree will be adapted. *space* is the whitespace to insert for each indentation level, two space characters by default. *level* is the initial indentation level. Setting this to a higher value than 0 can be used for indenting subtrees that are more deeply nested inside of a document. """ if isinstance(tree, ElementTree): tree = tree.getroot() if level < 0: raise ValueError(f"Initial indentation level must be >= 0, got {level}") if not len(tree): return # Reduce the memory consumption by reusing indentation strings. indentations = ["\n" + level * space] def _indent_children(elem, level): # Start a new indentation level for the first child. child_level = level + 1 try: child_indentation = indentations[child_level] except IndexError: child_indentation = indentations[level] + space indentations.append(child_indentation) if not elem.text or not elem.text.strip(): elem.text = child_indentation for child in elem: if len(child): _indent_children(child, child_level) if not child.tail or not child.tail.strip(): child.tail = child_indentation # Dedent after the last child by overwriting the previous indentation. if not child.tail.strip(): child.tail = indentations[level] _indent_children(tree, 0) # -------------------------------------------------------------------- # parsing def parse(source, parser=None): """Parse XML document into element tree. *source* is a filename or file object containing XML data, *parser* is an optional parser instance defaulting to XMLParser. Return an ElementTree instance. """ tree = ElementTree() tree.parse(source, parser) return tree def iterparse(source, events=None, parser=None): """Incrementally parse XML document into ElementTree. This class also reports what's going on to the user based on the *events* it is initialized with. The supported events are the strings "start", "end", "start-ns" and "end-ns" (the "ns" events are used to get detailed namespace information). If *events* is omitted, only "end" events are reported. *source* is a filename or file object containing XML data, *events* is a list of events to report back, *parser* is an optional parser instance. Returns an iterator providing (event, elem) pairs. """ # Use the internal, undocumented _parser argument for now; When the # parser argument of iterparse is removed, this can be killed. pullparser = XMLPullParser(events=events, _parser=parser) if not hasattr(source, "read"): source = open(source, "rb") close_source = True else: close_source = False def iterator(source): try: while True: yield from pullparser.read_events() # load event buffer data = source.read(16 * 1024) if not data: break pullparser.feed(data) root = pullparser._close_and_return_root() yield from pullparser.read_events() it = wr() if it is not None: it.root = root finally: if close_source: source.close() class IterParseIterator(collections.abc.Iterator): __next__ = iterator(source).__next__ def __del__(self): if close_source: source.close() it = IterParseIterator() it.root = None wr = weakref.ref(it) return it class XMLPullParser: def __init__(self, events=None, *, _parser=None): # The _parser argument is for internal use only and must not be relied # upon in user code. It will be removed in a future release. # See https://bugs.python.org/issue17741 for more details. self._events_queue = collections.deque() self._parser = _parser or XMLParser(target=TreeBuilder()) # wire up the parser for event reporting if events is None: events = ("end",) self._parser._setevents(self._events_queue, events) def feed(self, data): """Feed encoded data to parser.""" if self._parser is None: raise ValueError("feed() called after end of stream") if data: try: self._parser.feed(data) except SyntaxError as exc: self._events_queue.append(exc) def _close_and_return_root(self): # iterparse needs this to set its root attribute properly :( root = self._parser.close() self._parser = None return root def close(self): """Finish feeding data to parser. Unlike XMLParser, does not return the root element. Use read_events() to consume elements from XMLPullParser. """ self._close_and_return_root() def read_events(self): """Return an iterator over currently available (event, elem) pairs. Events are consumed from the internal event queue as they are retrieved from the iterator. """ events = self._events_queue while events: event = events.popleft() if isinstance(event, Exception): raise event else: yield event def flush(self): if self._parser is None: raise ValueError("flush() called after end of stream") self._parser.flush() def XML(text, parser=None): """Parse XML document from string constant. This function can be used to embed "XML Literals" in Python code. *text* is a string containing XML data, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an Element instance. """ if not parser: parser = XMLParser(target=TreeBuilder()) parser.feed(text) return parser.close() def XMLID(text, parser=None): """Parse XML document from string constant for its IDs. *text* is a string containing XML data, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an (Element, dict) tuple, in which the dict maps element id:s to elements. """ if not parser: parser = XMLParser(target=TreeBuilder()) parser.feed(text) tree = parser.close() ids = {} for elem in tree.iter(): id = elem.get("id") if id: ids[id] = elem return tree, ids # Parse XML document from string constant. Alias for XML(). fromstring = XML def fromstringlist(sequence, parser=None): """Parse XML document from sequence of string fragments. *sequence* is a list of other sequence, *parser* is an optional parser instance, defaulting to the standard XMLParser. Returns an Element instance. """ if not parser: parser = XMLParser(target=TreeBuilder()) for text in sequence: parser.feed(text) return parser.close() # -------------------------------------------------------------------- class TreeBuilder: """Generic element structure builder. This builder converts a sequence of start, data, and end method calls to a well-formed element structure. You can use this class to build an element structure using a custom XML parser, or a parser for some other XML-like format. *element_factory* is an optional element factory which is called to create new Element instances, as necessary. *comment_factory* is a factory to create comments to be used instead of the standard factory. If *insert_comments* is false (the default), comments will not be inserted into the tree. *pi_factory* is a factory to create processing instructions to be used instead of the standard factory. If *insert_pis* is false (the default), processing instructions will not be inserted into the tree. """ def __init__(self, element_factory=None, *, comment_factory=None, pi_factory=None, insert_comments=False, insert_pis=False): self._data = [] # data collector self._elem = [] # element stack self._last = None # last element self._root = None # root element self._tail = None # true if we're after an end tag if comment_factory is None: comment_factory = Comment self._comment_factory = comment_factory self.insert_comments = insert_comments if pi_factory is None: pi_factory = ProcessingInstruction self._pi_factory = pi_factory self.insert_pis = insert_pis if element_factory is None: element_factory = Element self._factory = element_factory def close(self): """Flush builder buffers and return toplevel document Element.""" assert len(self._elem) == 0, "missing end tags" assert self._root is not None, "missing toplevel element" return self._root def _flush(self): if self._data: if self._last is not None: text = "".join(self._data) if self._tail: assert self._last.tail is None, "internal error (tail)" self._last.tail = text else: assert self._last.text is None, "internal error (text)" self._last.text = text self._data = [] def data(self, data): """Add text to current element.""" self._data.append(data) def start(self, tag, attrs): """Open new element and return it. *tag* is the element name, *attrs* is a dict containing element attributes. """ self._flush() self._last = elem = self._factory(tag, attrs) if self._elem: self._elem[-1].append(elem) elif self._root is None: self._root = elem self._elem.append(elem) self._tail = 0 return elem def end(self, tag): """Close and return current Element. *tag* is the element name. """ self._flush() self._last = self._elem.pop() assert self._last.tag == tag,\ "end tag mismatch (expected %s, got %s)" % ( self._last.tag, tag) self._tail = 1 return self._last def comment(self, text): """Create a comment using the comment_factory. *text* is the text of the comment. """ return self._handle_single( self._comment_factory, self.insert_comments, text) def pi(self, target, text=None): """Create a processing instruction using the pi_factory. *target* is the target name of the processing instruction. *text* is the data of the processing instruction, or ''. """ return self._handle_single( self._pi_factory, self.insert_pis, target, text) def _handle_single(self, factory, insert, *args): elem = factory(*args) if insert: self._flush() self._last = elem if self._elem: self._elem[-1].append(elem) self._tail = 1 return elem # also see ElementTree and TreeBuilder class XMLParser: """Element structure builder for XML source data based on the expat parser. *target* is an optional target object which defaults to an instance of the standard TreeBuilder class, *encoding* is an optional encoding string which if given, overrides the encoding specified in the XML file: http://www.iana.org/assignments/character-sets """ def __init__(self, *, target=None, encoding=None): try: from xml.parsers import expat except ImportError: try: import pyexpat as expat except ImportError: raise ImportError( "No module named expat; use SimpleXMLTreeBuilder instead" ) parser = expat.ParserCreate(encoding, "}") if target is None: target = TreeBuilder() # underscored names are provided for compatibility only self.parser = self._parser = parser self.target = self._target = target self._error = expat.error self._names = {} # name memo cache # main callbacks parser.DefaultHandlerExpand = self._default if hasattr(target, 'start'): parser.StartElementHandler = self._start if hasattr(target, 'end'): parser.EndElementHandler = self._end if hasattr(target, 'start_ns'): parser.StartNamespaceDeclHandler = self._start_ns if hasattr(target, 'end_ns'): parser.EndNamespaceDeclHandler = self._end_ns if hasattr(target, 'data'): parser.CharacterDataHandler = target.data # miscellaneous callbacks if hasattr(target, 'comment'): parser.CommentHandler = target.comment if hasattr(target, 'pi'): parser.ProcessingInstructionHandler = target.pi # Configure pyexpat: buffering, new-style attribute handling. parser.buffer_text = 1 parser.ordered_attributes = 1 self._doctype = None self.entity = {} try: self.version = "Expat %d.%d.%d" % expat.version_info except AttributeError: pass # unknown def _setevents(self, events_queue, events_to_report): # Internal API for XMLPullParser # events_to_report: a list of events to report during parsing (same as # the *events* of XMLPullParser's constructor. # events_queue: a list of actual parsing events that will be populated # by the underlying parser. # parser = self._parser append = events_queue.append for event_name in events_to_report: if event_name == "start": parser.ordered_attributes = 1 def handler(tag, attrib_in, event=event_name, append=append, start=self._start): append((event, start(tag, attrib_in))) parser.StartElementHandler = handler elif event_name == "end": def handler(tag, event=event_name, append=append, end=self._end): append((event, end(tag))) parser.EndElementHandler = handler elif event_name == "start-ns": # TreeBuilder does not implement .start_ns() if hasattr(self.target, "start_ns"): def handler(prefix, uri, event=event_name, append=append, start_ns=self._start_ns): append((event, start_ns(prefix, uri))) else: def handler(prefix, uri, event=event_name, append=append): append((event, (prefix or '', uri or ''))) parser.StartNamespaceDeclHandler = handler elif event_name == "end-ns": # TreeBuilder does not implement .end_ns() if hasattr(self.target, "end_ns"): def handler(prefix, event=event_name, append=append, end_ns=self._end_ns): append((event, end_ns(prefix))) else: def handler(prefix, event=event_name, append=append): append((event, None)) parser.EndNamespaceDeclHandler = handler elif event_name == 'comment': def handler(text, event=event_name, append=append, self=self): append((event, self.target.comment(text))) parser.CommentHandler = handler elif event_name == 'pi': def handler(pi_target, data, event=event_name, append=append, self=self): append((event, self.target.pi(pi_target, data))) parser.ProcessingInstructionHandler = handler else: raise ValueError("unknown event %r" % event_name) def _raiseerror(self, value): err = ParseError(value) err.code = value.code err.position = value.lineno, value.offset raise err def _fixname(self, key): # expand qname, and convert name string to ascii, if possible try: name = self._names[key] except KeyError: name = key if "}" in name: name = "{" + name self._names[key] = name return name def _start_ns(self, prefix, uri): return self.target.start_ns(prefix or '', uri or '') def _end_ns(self, prefix): return self.target.end_ns(prefix or '') def _start(self, tag, attr_list): # Handler for expat's StartElementHandler. Since ordered_attributes # is set, the attributes are reported as a list of alternating # attribute name,value. fixname = self._fixname tag = fixname(tag) attrib = {} if attr_list: for i in range(0, len(attr_list), 2): attrib[fixname(attr_list[i])] = attr_list[i+1] return self.target.start(tag, attrib) def _end(self, tag): return self.target.end(self._fixname(tag)) def _default(self, text): prefix = text[:1] if prefix == "&": # deal with undefined entities try: data_handler = self.target.data except AttributeError: return try: data_handler(self.entity[text[1:-1]]) except KeyError: from xml.parsers import expat err = expat.error( "undefined entity %s: line %d, column %d" % (text, self.parser.ErrorLineNumber, self.parser.ErrorColumnNumber) ) err.code = 11 # XML_ERROR_UNDEFINED_ENTITY err.lineno = self.parser.ErrorLineNumber err.offset = self.parser.ErrorColumnNumber raise err elif prefix == "<" and text[:9] == "": self._doctype = None return text = text.strip() if not text: return self._doctype.append(text) n = len(self._doctype) if n > 2: type = self._doctype[1] if type == "PUBLIC" and n == 4: name, type, pubid, system = self._doctype if pubid: pubid = pubid[1:-1] elif type == "SYSTEM" and n == 3: name, type, system = self._doctype pubid = None else: return if hasattr(self.target, "doctype"): self.target.doctype(name, pubid, system[1:-1]) elif hasattr(self, "doctype"): warnings.warn( "The doctype() method of XMLParser is ignored. " "Define doctype() method on the TreeBuilder target.", RuntimeWarning) self._doctype = None def feed(self, data): """Feed encoded data to parser.""" try: self.parser.Parse(data, False) except self._error as v: self._raiseerror(v) def close(self): """Finish feeding data to parser and return element structure.""" try: self.parser.Parse(b"", True) # end of data except self._error as v: self._raiseerror(v) try: close_handler = self.target.close except AttributeError: pass else: return close_handler() finally: # get rid of circular references del self.parser, self._parser del self.target, self._target def flush(self): was_enabled = self.parser.GetReparseDeferralEnabled() try: self.parser.SetReparseDeferralEnabled(False) self.parser.Parse(b"", False) except self._error as v: self._raiseerror(v) finally: self.parser.SetReparseDeferralEnabled(was_enabled) # -------------------------------------------------------------------- # C14N 2.0 def canonicalize(xml_data=None, *, out=None, from_file=None, **options): """Convert XML to its C14N 2.0 serialised form. If *out* is provided, it must be a file or file-like object that receives the serialised canonical XML output (text, not bytes) through its ``.write()`` method. To write to a file, open it in text mode with encoding "utf-8". If *out* is not provided, this function returns the output as text string. Either *xml_data* (an XML string) or *from_file* (a file path or file-like object) must be provided as input. The configuration options are the same as for the ``C14NWriterTarget``. """ if xml_data is None and from_file is None: raise ValueError("Either 'xml_data' or 'from_file' must be provided as input") sio = None if out is None: sio = out = io.StringIO() parser = XMLParser(target=C14NWriterTarget(out.write, **options)) if xml_data is not None: parser.feed(xml_data) parser.close() elif from_file is not None: parse(from_file, parser=parser) return sio.getvalue() if sio is not None else None _looks_like_prefix_name = re.compile(r'^\w+:\w+$', re.UNICODE).match class C14NWriterTarget: """ Canonicalization writer target for the XMLParser. Serialises parse events to XML C14N 2.0. The *write* function is used for writing out the resulting data stream as text (not bytes). To write to a file, open it in text mode with encoding "utf-8" and pass its ``.write`` method. Configuration options: - *with_comments*: set to true to include comments - *strip_text*: set to true to strip whitespace before and after text content - *rewrite_prefixes*: set to true to replace namespace prefixes by "n{number}" - *qname_aware_tags*: a set of qname aware tag names in which prefixes should be replaced in text content - *qname_aware_attrs*: a set of qname aware attribute names in which prefixes should be replaced in text content - *exclude_attrs*: a set of attribute names that should not be serialised - *exclude_tags*: a set of tag names that should not be serialised """ def __init__(self, write, *, with_comments=False, strip_text=False, rewrite_prefixes=False, qname_aware_tags=None, qname_aware_attrs=None, exclude_attrs=None, exclude_tags=None): self._write = write self._data = [] self._with_comments = with_comments self._strip_text = strip_text self._exclude_attrs = set(exclude_attrs) if exclude_attrs else None self._exclude_tags = set(exclude_tags) if exclude_tags else None self._rewrite_prefixes = rewrite_prefixes if qname_aware_tags: self._qname_aware_tags = set(qname_aware_tags) else: self._qname_aware_tags = None if qname_aware_attrs: self._find_qname_aware_attrs = set(qname_aware_attrs).intersection else: self._find_qname_aware_attrs = None # Stack with globally and newly declared namespaces as (uri, prefix) pairs. self._declared_ns_stack = [[ ("http://www.w3.org/XML/1998/namespace", "xml"), ]] # Stack with user declared namespace prefixes as (uri, prefix) pairs. self._ns_stack = [] if not rewrite_prefixes: self._ns_stack.append(list(_namespace_map.items())) self._ns_stack.append([]) self._prefix_map = {} self._preserve_space = [False] self._pending_start = None self._root_seen = False self._root_done = False self._ignored_depth = 0 def _iter_namespaces(self, ns_stack, _reversed=reversed): for namespaces in _reversed(ns_stack): if namespaces: # almost no element declares new namespaces yield from namespaces def _resolve_prefix_name(self, prefixed_name): prefix, name = prefixed_name.split(':', 1) for uri, p in self._iter_namespaces(self._ns_stack): if p == prefix: return f'{{{uri}}}{name}' raise ValueError(f'Prefix {prefix} of QName "{prefixed_name}" is not declared in scope') def _qname(self, qname, uri=None): if uri is None: uri, tag = qname[1:].rsplit('}', 1) if qname[:1] == '{' else ('', qname) else: tag = qname prefixes_seen = set() for u, prefix in self._iter_namespaces(self._declared_ns_stack): if u == uri and prefix not in prefixes_seen: return f'{prefix}:{tag}' if prefix else tag, tag, uri prefixes_seen.add(prefix) # Not declared yet => add new declaration. if self._rewrite_prefixes: if uri in self._prefix_map: prefix = self._prefix_map[uri] else: prefix = self._prefix_map[uri] = f'n{len(self._prefix_map)}' self._declared_ns_stack[-1].append((uri, prefix)) return f'{prefix}:{tag}', tag, uri if not uri and '' not in prefixes_seen: # No default namespace declared => no prefix needed. return tag, tag, uri for u, prefix in self._iter_namespaces(self._ns_stack): if u == uri: self._declared_ns_stack[-1].append((uri, prefix)) return f'{prefix}:{tag}' if prefix else tag, tag, uri if not uri: # As soon as a default namespace is defined, # anything that has no namespace (and thus, no prefix) goes there. return tag, tag, uri raise ValueError(f'Namespace "{uri}" is not declared in scope') def data(self, data): if not self._ignored_depth: self._data.append(data) def _flush(self, _join_text=''.join): data = _join_text(self._data) del self._data[:] if self._strip_text and not self._preserve_space[-1]: data = data.strip() if self._pending_start is not None: args, self._pending_start = self._pending_start, None qname_text = data if data and _looks_like_prefix_name(data) else None self._start(*args, qname_text) if qname_text is not None: return if data and self._root_seen: self._write(_escape_cdata_c14n(data)) def start_ns(self, prefix, uri): if self._ignored_depth: return # we may have to resolve qnames in text content if self._data: self._flush() self._ns_stack[-1].append((uri, prefix)) def start(self, tag, attrs): if self._exclude_tags is not None and ( self._ignored_depth or tag in self._exclude_tags): self._ignored_depth += 1 return if self._data: self._flush() new_namespaces = [] self._declared_ns_stack.append(new_namespaces) if self._qname_aware_tags is not None and tag in self._qname_aware_tags: # Need to parse text first to see if it requires a prefix declaration. self._pending_start = (tag, attrs, new_namespaces) return self._start(tag, attrs, new_namespaces) def _start(self, tag, attrs, new_namespaces, qname_text=None): if self._exclude_attrs is not None and attrs: attrs = {k: v for k, v in attrs.items() if k not in self._exclude_attrs} qnames = {tag, *attrs} resolved_names = {} # Resolve prefixes in attribute and tag text. if qname_text is not None: qname = resolved_names[qname_text] = self._resolve_prefix_name(qname_text) qnames.add(qname) if self._find_qname_aware_attrs is not None and attrs: qattrs = self._find_qname_aware_attrs(attrs) if qattrs: for attr_name in qattrs: value = attrs[attr_name] if _looks_like_prefix_name(value): qname = resolved_names[value] = self._resolve_prefix_name(value) qnames.add(qname) else: qattrs = None else: qattrs = None # Assign prefixes in lexicographical order of used URIs. parse_qname = self._qname parsed_qnames = {n: parse_qname(n) for n in sorted( qnames, key=lambda n: n.split('}', 1))} # Write namespace declarations in prefix order ... if new_namespaces: attr_list = [ ('xmlns:' + prefix if prefix else 'xmlns', uri) for uri, prefix in new_namespaces ] attr_list.sort() else: # almost always empty attr_list = [] # ... followed by attributes in URI+name order if attrs: for k, v in sorted(attrs.items()): if qattrs is not None and k in qattrs and v in resolved_names: v = parsed_qnames[resolved_names[v]][0] attr_qname, attr_name, uri = parsed_qnames[k] # No prefix for attributes in default ('') namespace. attr_list.append((attr_qname if uri else attr_name, v)) # Honour xml:space attributes. space_behaviour = attrs.get('{http://www.w3.org/XML/1998/namespace}space') self._preserve_space.append( space_behaviour == 'preserve' if space_behaviour else self._preserve_space[-1]) # Write the tag. write = self._write write('<' + parsed_qnames[tag][0]) if attr_list: write(''.join([f' {k}="{_escape_attrib_c14n(v)}"' for k, v in attr_list])) write('>') # Write the resolved qname text content. if qname_text is not None: write(_escape_cdata_c14n(parsed_qnames[resolved_names[qname_text]][0])) self._root_seen = True self._ns_stack.append([]) def end(self, tag): if self._ignored_depth: self._ignored_depth -= 1 return if self._data: self._flush() self._write(f'') self._preserve_space.pop() self._root_done = len(self._preserve_space) == 1 self._declared_ns_stack.pop() self._ns_stack.pop() def comment(self, text): if not self._with_comments: return if self._ignored_depth: return if self._root_done: self._write('\n') elif self._root_seen and self._data: self._flush() self._write(f'') if not self._root_seen: self._write('\n') def pi(self, target, data): if self._ignored_depth: return if self._root_done: self._write('\n') elif self._root_seen and self._data: self._flush() self._write( f'' if data else f'') if not self._root_seen: self._write('\n') def _escape_cdata_c14n(text): # escape character data try: # it's worth avoiding do-nothing calls for strings that are # shorter than 500 character, or so. assume that's, by far, # the most common case in most applications. if '&' in text: text = text.replace('&', '&') if '<' in text: text = text.replace('<', '<') if '>' in text: text = text.replace('>', '>') if '\r' in text: text = text.replace('\r', ' ') return text except (TypeError, AttributeError): _raise_serialization_error(text) def _escape_attrib_c14n(text): # escape attribute value try: if '&' in text: text = text.replace('&', '&') if '<' in text: text = text.replace('<', '<') if '"' in text: text = text.replace('"', '"') if '\t' in text: text = text.replace('\t', ' ') if '\n' in text: text = text.replace('\n', ' ') if '\r' in text: text = text.replace('\r', ' ') return text except (TypeError, AttributeError): _raise_serialization_error(text) # -------------------------------------------------------------------- # Import the C accelerators try: # Element is going to be shadowed by the C implementation. We need to keep # the Python version of it accessible for some "creative" by external code # (see tests) _Element_Py = Element # Element, SubElement, ParseError, TreeBuilder, XMLParser, _set_factories from _elementtree import * from _elementtree import _set_factories except ImportError: pass else: _set_factories(Comment, ProcessingInstruction) PKN\etree/ElementInclude.pynu[# # ElementTree # $Id: ElementInclude.py 3375 2008-02-13 08:05:08Z fredrik $ # # limited xinclude support for element trees # # history: # 2003-08-15 fl created # 2003-11-14 fl fixed default loader # # Copyright (c) 2003-2004 by Fredrik Lundh. All rights reserved. # # fredrik@pythonware.com # http://www.pythonware.com # # -------------------------------------------------------------------- # The ElementTree toolkit is # # Copyright (c) 1999-2008 by Fredrik Lundh # # By obtaining, using, and/or copying this software and/or its # associated documentation, you agree that you have read, understood, # and will comply with the following terms and conditions: # # Permission to use, copy, modify, and distribute this software and # its associated documentation for any purpose and without fee is # hereby granted, provided that the above copyright notice appears in # all copies, and that both that copyright notice and this permission # notice appear in supporting documentation, and that the name of # Secret Labs AB or the author not be used in advertising or publicity # pertaining to distribution of the software without specific, written # prior permission. # # SECRET LABS AB AND THE AUTHOR DISCLAIMS ALL WARRANTIES WITH REGARD # TO THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANT- # ABILITY AND FITNESS. IN NO EVENT SHALL SECRET LABS AB OR THE AUTHOR # BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY # DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, # WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS # ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE # OF THIS SOFTWARE. # -------------------------------------------------------------------- # Licensed to PSF under a Contributor Agreement. # See https://www.python.org/psf/license for licensing details. ## # Limited XInclude support for the ElementTree package. ## import copy from . import ElementTree from urllib.parse import urljoin XINCLUDE = "{http://www.w3.org/2001/XInclude}" XINCLUDE_INCLUDE = XINCLUDE + "include" XINCLUDE_FALLBACK = XINCLUDE + "fallback" # For security reasons, the inclusion depth is limited to this read-only value by default. DEFAULT_MAX_INCLUSION_DEPTH = 6 ## # Fatal include error. class FatalIncludeError(SyntaxError): pass class LimitedRecursiveIncludeError(FatalIncludeError): pass ## # Default loader. This loader reads an included resource from disk. # # @param href Resource reference. # @param parse Parse mode. Either "xml" or "text". # @param encoding Optional text encoding (UTF-8 by default for "text"). # @return The expanded resource. If the parse mode is "xml", this # is an ElementTree instance. If the parse mode is "text", this # is a Unicode string. If the loader fails, it can return None # or raise an OSError exception. # @throws OSError If the loader fails to load the resource. def default_loader(href, parse, encoding=None): if parse == "xml": with open(href, 'rb') as file: data = ElementTree.parse(file).getroot() else: if not encoding: encoding = 'UTF-8' with open(href, 'r', encoding=encoding) as file: data = file.read() return data ## # Expand XInclude directives. # # @param elem Root element. # @param loader Optional resource loader. If omitted, it defaults # to {@link default_loader}. If given, it should be a callable # that implements the same interface as default_loader. # @param base_url The base URL of the original file, to resolve # relative include file references. # @param max_depth The maximum number of recursive inclusions. # Limited to reduce the risk of malicious content explosion. # Pass a negative value to disable the limitation. # @throws LimitedRecursiveIncludeError If the {@link max_depth} was exceeded. # @throws FatalIncludeError If the function fails to include a given # resource, or if the tree contains malformed XInclude elements. # @throws IOError If the function fails to load a given resource. # @returns the node or its replacement if it was an XInclude node def include(elem, loader=None, base_url=None, max_depth=DEFAULT_MAX_INCLUSION_DEPTH): if max_depth is None: max_depth = -1 elif max_depth < 0: raise ValueError("expected non-negative depth or None for 'max_depth', got %r" % max_depth) if hasattr(elem, 'getroot'): elem = elem.getroot() if loader is None: loader = default_loader _include(elem, loader, base_url, max_depth, set()) def _include(elem, loader, base_url, max_depth, _parent_hrefs): # look for xinclude elements i = 0 while i < len(elem): e = elem[i] if e.tag == XINCLUDE_INCLUDE: # process xinclude directive href = e.get("href") if base_url: href = urljoin(base_url, href) parse = e.get("parse", "xml") if parse == "xml": if href in _parent_hrefs: raise FatalIncludeError("recursive include of %s" % href) if max_depth == 0: raise LimitedRecursiveIncludeError( "maximum xinclude depth reached when including file %s" % href) _parent_hrefs.add(href) node = loader(href, parse) if node is None: raise FatalIncludeError( "cannot load %r as %r" % (href, parse) ) node = copy.copy(node) # FIXME: this makes little sense with recursive includes _include(node, loader, href, max_depth - 1, _parent_hrefs) _parent_hrefs.remove(href) if e.tail: node.tail = (node.tail or "") + e.tail elem[i] = node elif parse == "text": text = loader(href, parse, e.get("encoding")) if text is None: raise FatalIncludeError( "cannot load %r as %r" % (href, parse) ) if e.tail: text += e.tail if i: node = elem[i-1] node.tail = (node.tail or "") + text else: elem.text = (elem.text or "") + text del elem[i] continue else: raise FatalIncludeError( "unknown parse type in xi:include tag (%r)" % parse ) elif e.tag == XINCLUDE_FALLBACK: raise FatalIncludeError( "xi:fallback tag must be child of xi:include (%r)" % e.tag ) else: _include(e, loader, base_url, max_depth, _parent_hrefs) i += 1 PKN\2QEEetree/__init__.pynu[# $Id: __init__.py 3375 2008-02-13 08:05:08Z fredrik $ # elementtree package # -------------------------------------------------------------------- # The ElementTree toolkit is # # Copyright (c) 1999-2008 by Fredrik Lundh # # By obtaining, using, and/or copying this software and/or its # associated documentation, you agree that you have read, understood, # and will comply with the following terms and conditions: # # Permission to use, copy, modify, and distribute this software and # its associated documentation for any purpose and without fee is # hereby granted, provided that the above copyright notice appears in # all copies, and that both that copyright notice and this permission # notice appear in supporting documentation, and that the name of # Secret Labs AB or the author not be used in advertising or publicity # pertaining to distribution of the software without specific, written # prior permission. # # SECRET LABS AB AND THE AUTHOR DISCLAIMS ALL WARRANTIES WITH REGARD # TO THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANT- # ABILITY AND FITNESS. IN NO EVENT SHALL SECRET LABS AB OR THE AUTHOR # BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY # DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, # WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS # ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE # OF THIS SOFTWARE. # -------------------------------------------------------------------- # Licensed to PSF under a Contributor Agreement. # See https://www.python.org/psf/license for licensing details. PKN\}Fsax/_exceptions.pynu["""Different kinds of SAX Exceptions""" import sys if sys.platform[:4] == "java": from java.lang import Exception del sys # ===== SAXEXCEPTION ===== class SAXException(Exception): """Encapsulate an XML error or warning. This class can contain basic error or warning information from either the XML parser or the application: you can subclass it to provide additional functionality, or to add localization. Note that although you will receive a SAXException as the argument to the handlers in the ErrorHandler interface, you are not actually required to raise the exception; instead, you can simply read the information in it.""" def __init__(self, msg, exception=None): """Creates an exception. The message is required, but the exception is optional.""" self._msg = msg self._exception = exception Exception.__init__(self, msg) def getMessage(self): "Return a message for this exception." return self._msg def getException(self): "Return the embedded exception, or None if there was none." return self._exception def __str__(self): "Create a string representation of the exception." return self._msg def __getitem__(self, ix): """Avoids weird error messages if someone does exception[ix] by mistake, since Exception has __getitem__ defined.""" raise AttributeError("__getitem__") # ===== SAXPARSEEXCEPTION ===== class SAXParseException(SAXException): """Encapsulate an XML parse error or warning. This exception will include information for locating the error in the original XML document. Note that although the application will receive a SAXParseException as the argument to the handlers in the ErrorHandler interface, the application is not actually required to raise the exception; instead, it can simply read the information in it and take a different action. Since this exception is a subclass of SAXException, it inherits the ability to wrap another exception.""" def __init__(self, msg, exception, locator): "Creates the exception. The exception parameter is allowed to be None." SAXException.__init__(self, msg, exception) self._locator = locator # We need to cache this stuff at construction time. # If this exception is raised, the objects through which we must # traverse to get this information may be deleted by the time # it gets caught. self._systemId = self._locator.getSystemId() self._colnum = self._locator.getColumnNumber() self._linenum = self._locator.getLineNumber() def getColumnNumber(self): """The column number of the end of the text where the exception occurred.""" return self._colnum def getLineNumber(self): "The line number of the end of the text where the exception occurred." return self._linenum def getPublicId(self): "Get the public identifier of the entity where the exception occurred." return self._locator.getPublicId() def getSystemId(self): "Get the system identifier of the entity where the exception occurred." return self._systemId def __str__(self): "Create a string representation of the exception." sysid = self.getSystemId() if sysid is None: sysid = "" linenum = self.getLineNumber() if linenum is None: linenum = "?" colnum = self.getColumnNumber() if colnum is None: colnum = "?" return "%s:%s:%s: %s" % (sysid, linenum, colnum, self._msg) # ===== SAXNOTRECOGNIZEDEXCEPTION ===== class SAXNotRecognizedException(SAXException): """Exception class for an unrecognized identifier. An XMLReader will raise this exception when it is confronted with an unrecognized feature or property. SAX applications and extensions may use this class for similar purposes.""" # ===== SAXNOTSUPPORTEDEXCEPTION ===== class SAXNotSupportedException(SAXException): """Exception class for an unsupported operation. An XMLReader will raise this exception when a service it cannot perform is requested (specifically setting a state or value). SAX applications and extensions may use this class for similar purposes.""" # ===== SAXNOTSUPPORTEDEXCEPTION ===== class SAXReaderNotAvailable(SAXNotSupportedException): """Exception class for a missing driver. An XMLReader module (driver) should raise this exception when it is first imported, e.g. when a support module cannot be imported. It also may be raised during parsing, e.g. if executing an external program is not permitted.""" PKN\//sax/saxutils.pynu["""\ A library of useful helper classes to the SAX classes, for the convenience of application and driver writers. """ import os, urllib.parse, urllib.request import io import codecs from . import handler from . import xmlreader def __dict_replace(s, d): """Replace substrings of a string using a dictionary.""" for key, value in d.items(): s = s.replace(key, value) return s def escape(data, entities={}): """Escape &, <, and > in a string of data. You can escape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. """ # must do ampersand first data = data.replace("&", "&") data = data.replace(">", ">") data = data.replace("<", "<") if entities: data = __dict_replace(data, entities) return data def unescape(data, entities={}): """Unescape &, <, and > in a string of data. You can unescape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. """ data = data.replace("<", "<") data = data.replace(">", ">") if entities: data = __dict_replace(data, entities) # must do ampersand last return data.replace("&", "&") def quoteattr(data, entities={}): """Escape and quote an attribute value. Escape &, <, and > in a string of data, then quote it for use as an attribute value. The \" character will be escaped as well, if necessary. You can escape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. """ entities = {**entities, '\n': ' ', '\r': ' ', '\t':' '} data = escape(data, entities) if '"' in data: if "'" in data: data = '"%s"' % data.replace('"', """) else: data = "'%s'" % data else: data = '"%s"' % data return data def _gettextwriter(out, encoding): if out is None: import sys return sys.stdout if isinstance(out, io.TextIOBase): # use a text writer as is return out if isinstance(out, (codecs.StreamWriter, codecs.StreamReaderWriter)): # use a codecs stream writer as is return out # wrap a binary writer with TextIOWrapper if isinstance(out, io.RawIOBase): # Keep the original file open when the TextIOWrapper is # destroyed class _wrapper: __class__ = out.__class__ def __getattr__(self, name): return getattr(out, name) buffer = _wrapper() buffer.close = lambda: None else: # This is to handle passed objects that aren't in the # IOBase hierarchy, but just have a write method buffer = io.BufferedIOBase() buffer.writable = lambda: True buffer.write = out.write try: # TextIOWrapper uses this methods to determine # if BOM (for UTF-16, etc) should be added buffer.seekable = out.seekable buffer.tell = out.tell except AttributeError: pass return io.TextIOWrapper(buffer, encoding=encoding, errors='xmlcharrefreplace', newline='\n', write_through=True) class XMLGenerator(handler.ContentHandler): def __init__(self, out=None, encoding="iso-8859-1", short_empty_elements=False): handler.ContentHandler.__init__(self) out = _gettextwriter(out, encoding) self._write = out.write self._flush = out.flush self._ns_contexts = [{}] # contains uri -> prefix dicts self._current_context = self._ns_contexts[-1] self._undeclared_ns_maps = [] self._encoding = encoding self._short_empty_elements = short_empty_elements self._pending_start_element = False def _qname(self, name): """Builds a qualified name from a (ns_url, localname) pair""" if name[0]: # Per http://www.w3.org/XML/1998/namespace, The 'xml' prefix is # bound by definition to http://www.w3.org/XML/1998/namespace. It # does not need to be declared and will not usually be found in # self._current_context. if 'http://www.w3.org/XML/1998/namespace' == name[0]: return 'xml:' + name[1] # The name is in a non-empty namespace prefix = self._current_context[name[0]] if prefix: # If it is not the default namespace, prepend the prefix return prefix + ":" + name[1] # Return the unqualified name return name[1] def _finish_pending_start_element(self,endElement=False): if self._pending_start_element: self._write('>') self._pending_start_element = False # ContentHandler methods def startDocument(self): self._write('\n' % self._encoding) def endDocument(self): self._flush() def startPrefixMapping(self, prefix, uri): self._ns_contexts.append(self._current_context.copy()) self._current_context[uri] = prefix self._undeclared_ns_maps.append((prefix, uri)) def endPrefixMapping(self, prefix): self._current_context = self._ns_contexts[-1] del self._ns_contexts[-1] def startElement(self, name, attrs): self._finish_pending_start_element() self._write('<' + name) for (name, value) in attrs.items(): self._write(' %s=%s' % (name, quoteattr(value))) if self._short_empty_elements: self._pending_start_element = True else: self._write(">") def endElement(self, name): if self._pending_start_element: self._write('/>') self._pending_start_element = False else: self._write('' % name) def startElementNS(self, name, qname, attrs): self._finish_pending_start_element() self._write('<' + self._qname(name)) for prefix, uri in self._undeclared_ns_maps: if prefix: self._write(' xmlns:%s="%s"' % (prefix, uri)) else: self._write(' xmlns="%s"' % uri) self._undeclared_ns_maps = [] for (name, value) in attrs.items(): self._write(' %s=%s' % (self._qname(name), quoteattr(value))) if self._short_empty_elements: self._pending_start_element = True else: self._write(">") def endElementNS(self, name, qname): if self._pending_start_element: self._write('/>') self._pending_start_element = False else: self._write('' % self._qname(name)) def characters(self, content): if content: self._finish_pending_start_element() if not isinstance(content, str): content = str(content, self._encoding) self._write(escape(content)) def ignorableWhitespace(self, content): if content: self._finish_pending_start_element() if not isinstance(content, str): content = str(content, self._encoding) self._write(content) def processingInstruction(self, target, data): self._finish_pending_start_element() self._write('' % (target, data)) class XMLFilterBase(xmlreader.XMLReader): """This class is designed to sit between an XMLReader and the client application's event handlers. By default, it does nothing but pass requests up to the reader and events on to the handlers unmodified, but subclasses can override specific methods to modify the event stream or the configuration requests as they pass through.""" def __init__(self, parent = None): xmlreader.XMLReader.__init__(self) self._parent = parent # ErrorHandler methods def error(self, exception): self._err_handler.error(exception) def fatalError(self, exception): self._err_handler.fatalError(exception) def warning(self, exception): self._err_handler.warning(exception) # ContentHandler methods def setDocumentLocator(self, locator): self._cont_handler.setDocumentLocator(locator) def startDocument(self): self._cont_handler.startDocument() def endDocument(self): self._cont_handler.endDocument() def startPrefixMapping(self, prefix, uri): self._cont_handler.startPrefixMapping(prefix, uri) def endPrefixMapping(self, prefix): self._cont_handler.endPrefixMapping(prefix) def startElement(self, name, attrs): self._cont_handler.startElement(name, attrs) def endElement(self, name): self._cont_handler.endElement(name) def startElementNS(self, name, qname, attrs): self._cont_handler.startElementNS(name, qname, attrs) def endElementNS(self, name, qname): self._cont_handler.endElementNS(name, qname) def characters(self, content): self._cont_handler.characters(content) def ignorableWhitespace(self, chars): self._cont_handler.ignorableWhitespace(chars) def processingInstruction(self, target, data): self._cont_handler.processingInstruction(target, data) def skippedEntity(self, name): self._cont_handler.skippedEntity(name) # DTDHandler methods def notationDecl(self, name, publicId, systemId): self._dtd_handler.notationDecl(name, publicId, systemId) def unparsedEntityDecl(self, name, publicId, systemId, ndata): self._dtd_handler.unparsedEntityDecl(name, publicId, systemId, ndata) # EntityResolver methods def resolveEntity(self, publicId, systemId): return self._ent_handler.resolveEntity(publicId, systemId) # XMLReader methods def parse(self, source): self._parent.setContentHandler(self) self._parent.setErrorHandler(self) self._parent.setEntityResolver(self) self._parent.setDTDHandler(self) self._parent.parse(source) def setLocale(self, locale): self._parent.setLocale(locale) def getFeature(self, name): return self._parent.getFeature(name) def setFeature(self, name, state): self._parent.setFeature(name, state) def getProperty(self, name): return self._parent.getProperty(name) def setProperty(self, name, value): self._parent.setProperty(name, value) # XMLFilter methods def getParent(self): return self._parent def setParent(self, parent): self._parent = parent # --- Utility functions def prepare_input_source(source, base=""): """This function takes an InputSource and an optional base URL and returns a fully resolved InputSource object ready for reading.""" if isinstance(source, os.PathLike): source = os.fspath(source) if isinstance(source, str): source = xmlreader.InputSource(source) elif hasattr(source, "read"): f = source source = xmlreader.InputSource() if isinstance(f.read(0), str): source.setCharacterStream(f) else: source.setByteStream(f) if hasattr(f, "name") and isinstance(f.name, str): source.setSystemId(f.name) if source.getCharacterStream() is None and source.getByteStream() is None: sysid = source.getSystemId() basehead = os.path.dirname(os.path.normpath(base)) sysidfilename = os.path.join(basehead, sysid) if os.path.isfile(sysidfilename): source.setSystemId(sysidfilename) f = open(sysidfilename, "rb") else: source.setSystemId(urllib.parse.urljoin(base, sysid)) f = urllib.request.urlopen(source.getSystemId()) source.setByteStream(f) return source PKN\9==sax/handler.pynu[""" This module contains the core classes of version 2.0 of SAX for Python. This file provides only default classes with absolutely minimum functionality, from which drivers and applications can be subclassed. Many of these classes are empty and are included only as documentation of the interfaces. $Id$ """ version = '2.0beta' #============================================================================ # # HANDLER INTERFACES # #============================================================================ # ===== ERRORHANDLER ===== class ErrorHandler: """Basic interface for SAX error handlers. If you create an object that implements this interface, then register the object with your XMLReader, the parser will call the methods in your object to report all warnings and errors. There are three levels of errors available: warnings, (possibly) recoverable errors, and unrecoverable errors. All methods take a SAXParseException as the only parameter.""" def error(self, exception): "Handle a recoverable error." raise exception def fatalError(self, exception): "Handle a non-recoverable error." raise exception def warning(self, exception): "Handle a warning." print(exception) # ===== CONTENTHANDLER ===== class ContentHandler: """Interface for receiving logical document content events. This is the main callback interface in SAX, and the one most important to applications. The order of events in this interface mirrors the order of the information in the document.""" def __init__(self): self._locator = None def setDocumentLocator(self, locator): """Called by the parser to give the application a locator for locating the origin of document events. SAX parsers are strongly encouraged (though not absolutely required) to supply a locator: if it does so, it must supply the locator to the application by invoking this method before invoking any of the other methods in the DocumentHandler interface. The locator allows the application to determine the end position of any document-related event, even if the parser is not reporting an error. Typically, the application will use this information for reporting its own errors (such as character content that does not match an application's business rules). The information returned by the locator is probably not sufficient for use with a search engine. Note that the locator will return correct information only during the invocation of the events in this interface. The application should not attempt to use it at any other time.""" self._locator = locator def startDocument(self): """Receive notification of the beginning of a document. The SAX parser will invoke this method only once, before any other methods in this interface or in DTDHandler (except for setDocumentLocator).""" def endDocument(self): """Receive notification of the end of a document. The SAX parser will invoke this method only once, and it will be the last method invoked during the parse. The parser shall not invoke this method until it has either abandoned parsing (because of an unrecoverable error) or reached the end of input.""" def startPrefixMapping(self, prefix, uri): """Begin the scope of a prefix-URI Namespace mapping. The information from this event is not necessary for normal Namespace processing: the SAX XML reader will automatically replace prefixes for element and attribute names when the http://xml.org/sax/features/namespaces feature is true (the default). There are cases, however, when applications need to use prefixes in character data or in attribute values, where they cannot safely be expanded automatically; the start/endPrefixMapping event supplies the information to the application to expand prefixes in those contexts itself, if necessary. Note that start/endPrefixMapping events are not guaranteed to be properly nested relative to each-other: all startPrefixMapping events will occur before the corresponding startElement event, and all endPrefixMapping events will occur after the corresponding endElement event, but their order is not guaranteed.""" def endPrefixMapping(self, prefix): """End the scope of a prefix-URI mapping. See startPrefixMapping for details. This event will always occur after the corresponding endElement event, but the order of endPrefixMapping events is not otherwise guaranteed.""" def startElement(self, name, attrs): """Signals the start of an element in non-namespace mode. The name parameter contains the raw XML 1.0 name of the element type as a string and the attrs parameter holds an instance of the Attributes class containing the attributes of the element.""" def endElement(self, name): """Signals the end of an element in non-namespace mode. The name parameter contains the name of the element type, just as with the startElement event.""" def startElementNS(self, name, qname, attrs): """Signals the start of an element in namespace mode. The name parameter contains the name of the element type as a (uri, localname) tuple, the qname parameter the raw XML 1.0 name used in the source document, and the attrs parameter holds an instance of the Attributes class containing the attributes of the element. The uri part of the name tuple is None for elements which have no namespace.""" def endElementNS(self, name, qname): """Signals the end of an element in namespace mode. The name parameter contains the name of the element type, just as with the startElementNS event.""" def characters(self, content): """Receive notification of character data. The Parser will call this method to report each chunk of character data. SAX parsers may return all contiguous character data in a single chunk, or they may split it into several chunks; however, all of the characters in any single event must come from the same external entity so that the Locator provides useful information.""" def ignorableWhitespace(self, whitespace): """Receive notification of ignorable whitespace in element content. Validating Parsers must use this method to report each chunk of ignorable whitespace (see the W3C XML 1.0 recommendation, section 2.10): non-validating parsers may also use this method if they are capable of parsing and using content models. SAX parsers may return all contiguous whitespace in a single chunk, or they may split it into several chunks; however, all of the characters in any single event must come from the same external entity, so that the Locator provides useful information.""" def processingInstruction(self, target, data): """Receive notification of a processing instruction. The Parser will invoke this method once for each processing instruction found: note that processing instructions may occur before or after the main document element. A SAX parser should never report an XML declaration (XML 1.0, section 2.8) or a text declaration (XML 1.0, section 4.3.1) using this method.""" def skippedEntity(self, name): """Receive notification of a skipped entity. The Parser will invoke this method once for each entity skipped. Non-validating processors may skip entities if they have not seen the declarations (because, for example, the entity was declared in an external DTD subset). All processors may skip external entities, depending on the values of the http://xml.org/sax/features/external-general-entities and the http://xml.org/sax/features/external-parameter-entities properties.""" # ===== DTDHandler ===== class DTDHandler: """Handle DTD events. This interface specifies only those DTD events required for basic parsing (unparsed entities and attributes).""" def notationDecl(self, name, publicId, systemId): "Handle a notation declaration event." def unparsedEntityDecl(self, name, publicId, systemId, ndata): "Handle an unparsed entity declaration event." # ===== ENTITYRESOLVER ===== class EntityResolver: """Basic interface for resolving entities. If you create an object implementing this interface, then register the object with your Parser, the parser will call the method in your object to resolve all external entities. Note that DefaultHandler implements this interface with the default behaviour.""" def resolveEntity(self, publicId, systemId): """Resolve the system identifier of an entity and return either the system identifier to read from as a string, or an InputSource to read from.""" return systemId #============================================================================ # # CORE FEATURES # #============================================================================ feature_namespaces = "http://xml.org/sax/features/namespaces" # true: Perform Namespace processing (default). # false: Optionally do not perform Namespace processing # (implies namespace-prefixes). # access: (parsing) read-only; (not parsing) read/write feature_namespace_prefixes = "http://xml.org/sax/features/namespace-prefixes" # true: Report the original prefixed names and attributes used for Namespace # declarations. # false: Do not report attributes used for Namespace declarations, and # optionally do not report original prefixed names (default). # access: (parsing) read-only; (not parsing) read/write feature_string_interning = "http://xml.org/sax/features/string-interning" # true: All element names, prefixes, attribute names, Namespace URIs, and # local names are interned using the built-in intern function. # false: Names are not necessarily interned, although they may be (default). # access: (parsing) read-only; (not parsing) read/write feature_validation = "http://xml.org/sax/features/validation" # true: Report all validation errors (implies external-general-entities and # external-parameter-entities). # false: Do not report validation errors. # access: (parsing) read-only; (not parsing) read/write feature_external_ges = "http://xml.org/sax/features/external-general-entities" # true: Include all external general (text) entities. # false: Do not include external general entities. # access: (parsing) read-only; (not parsing) read/write feature_external_pes = "http://xml.org/sax/features/external-parameter-entities" # true: Include all external parameter entities, including the external # DTD subset. # false: Do not include any external parameter entities, even the external # DTD subset. # access: (parsing) read-only; (not parsing) read/write all_features = [feature_namespaces, feature_namespace_prefixes, feature_string_interning, feature_validation, feature_external_ges, feature_external_pes] #============================================================================ # # CORE PROPERTIES # #============================================================================ property_lexical_handler = "http://xml.org/sax/properties/lexical-handler" # data type: xml.sax.sax2lib.LexicalHandler # description: An optional extension handler for lexical events like comments. # access: read/write property_declaration_handler = "http://xml.org/sax/properties/declaration-handler" # data type: xml.sax.sax2lib.DeclHandler # description: An optional extension handler for DTD-related events other # than notations and unparsed entities. # access: read/write property_dom_node = "http://xml.org/sax/properties/dom-node" # data type: org.w3c.dom.Node # description: When parsing, the current DOM node being visited if this is # a DOM iterator; when not parsing, the root DOM node for # iteration. # access: (parsing) read-only; (not parsing) read/write property_xml_string = "http://xml.org/sax/properties/xml-string" # data type: String # description: The literal string of characters that was the source for # the current event. # access: read-only property_encoding = "http://www.python.org/sax/properties/encoding" # data type: String # description: The name of the encoding to assume for input data. # access: write: set the encoding, e.g. established by a higher-level # protocol. May change during parsing (e.g. after # processing a META tag) # read: return the current encoding (possibly established through # auto-detection. # initial value: UTF-8 # property_interning_dict = "http://www.python.org/sax/properties/interning-dict" # data type: Dictionary # description: The dictionary used to intern common strings in the document # access: write: Request that the parser uses a specific dictionary, to # allow interning across different documents # read: return the current interning dictionary, or None # all_properties = [property_lexical_handler, property_dom_node, property_declaration_handler, property_xml_string, property_encoding, property_interning_dict] class LexicalHandler: """Optional SAX2 handler for lexical events. This handler is used to obtain lexical information about an XML document, that is, information about how the document was encoded (as opposed to what it contains, which is reported to the ContentHandler), such as comments and CDATA marked section boundaries. To set the LexicalHandler of an XMLReader, use the setProperty method with the property identifier 'http://xml.org/sax/properties/lexical-handler'.""" def comment(self, content): """Reports a comment anywhere in the document (including the DTD and outside the document element). content is a string that holds the contents of the comment.""" def startDTD(self, name, public_id, system_id): """Report the start of the DTD declarations, if the document has an associated DTD. A startEntity event will be reported before declaration events from the external DTD subset are reported, and this can be used to infer from which subset DTD declarations derive. name is the name of the document element type, public_id the public identifier of the DTD (or None if none were supplied) and system_id the system identfier of the external subset (or None if none were supplied).""" def endDTD(self): """Signals the end of DTD declarations.""" def startCDATA(self): """Reports the beginning of a CDATA marked section. The contents of the CDATA marked section will be reported through the characters event.""" def endCDATA(self): """Reports the end of a CDATA marked section.""" PKN\&211sax/xmlreader.pynu["""An XML Reader is the SAX 2 name for an XML parser. XML Parsers should be based on this code. """ from . import handler from ._exceptions import SAXNotSupportedException, SAXNotRecognizedException # ===== XMLREADER ===== class XMLReader: """Interface for reading an XML document using callbacks. XMLReader is the interface that an XML parser's SAX2 driver must implement. This interface allows an application to set and query features and properties in the parser, to register event handlers for document processing, and to initiate a document parse. All SAX interfaces are assumed to be synchronous: the parse methods must not return until parsing is complete, and readers must wait for an event-handler callback to return before reporting the next event.""" def __init__(self): self._cont_handler = handler.ContentHandler() self._dtd_handler = handler.DTDHandler() self._ent_handler = handler.EntityResolver() self._err_handler = handler.ErrorHandler() def parse(self, source): "Parse an XML document from a system identifier or an InputSource." raise NotImplementedError("This method must be implemented!") def getContentHandler(self): "Returns the current ContentHandler." return self._cont_handler def setContentHandler(self, handler): "Registers a new object to receive document content events." self._cont_handler = handler def getDTDHandler(self): "Returns the current DTD handler." return self._dtd_handler def setDTDHandler(self, handler): "Register an object to receive basic DTD-related events." self._dtd_handler = handler def getEntityResolver(self): "Returns the current EntityResolver." return self._ent_handler def setEntityResolver(self, resolver): "Register an object to resolve external entities." self._ent_handler = resolver def getErrorHandler(self): "Returns the current ErrorHandler." return self._err_handler def setErrorHandler(self, handler): "Register an object to receive error-message events." self._err_handler = handler def setLocale(self, locale): """Allow an application to set the locale for errors and warnings. SAX parsers are not required to provide localization for errors and warnings; if they cannot support the requested locale, however, they must raise a SAX exception. Applications may request a locale change in the middle of a parse.""" raise SAXNotSupportedException("Locale support not implemented") def getFeature(self, name): "Looks up and returns the state of a SAX2 feature." raise SAXNotRecognizedException("Feature '%s' not recognized" % name) def setFeature(self, name, state): "Sets the state of a SAX2 feature." raise SAXNotRecognizedException("Feature '%s' not recognized" % name) def getProperty(self, name): "Looks up and returns the value of a SAX2 property." raise SAXNotRecognizedException("Property '%s' not recognized" % name) def setProperty(self, name, value): "Sets the value of a SAX2 property." raise SAXNotRecognizedException("Property '%s' not recognized" % name) class IncrementalParser(XMLReader): """This interface adds three extra methods to the XMLReader interface that allow XML parsers to support incremental parsing. Support for this interface is optional, since not all underlying XML parsers support this functionality. When the parser is instantiated it is ready to begin accepting data from the feed method immediately. After parsing has been finished with a call to close the reset method must be called to make the parser ready to accept new data, either from feed or using the parse method. Note that these methods must _not_ be called during parsing, that is, after parse has been called and before it returns. By default, the class also implements the parse method of the XMLReader interface using the feed, close and reset methods of the IncrementalParser interface as a convenience to SAX 2.0 driver writers.""" def __init__(self, bufsize=2**16): self._bufsize = bufsize XMLReader.__init__(self) def parse(self, source): from . import saxutils source = saxutils.prepare_input_source(source) self.prepareParser(source) file = source.getCharacterStream() if file is None: file = source.getByteStream() buffer = file.read(self._bufsize) while buffer: self.feed(buffer) buffer = file.read(self._bufsize) self.close() def feed(self, data): """This method gives the raw XML data in the data parameter to the parser and makes it parse the data, emitting the corresponding events. It is allowed for XML constructs to be split across several calls to feed. feed may raise SAXException.""" raise NotImplementedError("This method must be implemented!") def prepareParser(self, source): """This method is called by the parse implementation to allow the SAX 2.0 driver to prepare itself for parsing.""" raise NotImplementedError("prepareParser must be overridden!") def close(self): """This method is called when the entire XML document has been passed to the parser through the feed method, to notify the parser that there are no more data. This allows the parser to do the final checks on the document and empty the internal data buffer. The parser will not be ready to parse another document until the reset method has been called. close may raise SAXException.""" raise NotImplementedError("This method must be implemented!") def reset(self): """This method is called after close has been called to reset the parser so that it is ready to parse new documents. The results of calling parse or feed after close without calling reset are undefined.""" raise NotImplementedError("This method must be implemented!") # ===== LOCATOR ===== class Locator: """Interface for associating a SAX event with a document location. A locator object will return valid results only during calls to DocumentHandler methods; at any other time, the results are unpredictable.""" def getColumnNumber(self): "Return the column number where the current event ends." return -1 def getLineNumber(self): "Return the line number where the current event ends." return -1 def getPublicId(self): "Return the public identifier for the current event." return None def getSystemId(self): "Return the system identifier for the current event." return None # ===== INPUTSOURCE ===== class InputSource: """Encapsulation of the information needed by the XMLReader to read entities. This class may include information about the public identifier, system identifier, byte stream (possibly with character encoding information) and/or the character stream of an entity. Applications will create objects of this class for use in the XMLReader.parse method and for returning from EntityResolver.resolveEntity. An InputSource belongs to the application, the XMLReader is not allowed to modify InputSource objects passed to it from the application, although it may make copies and modify those.""" def __init__(self, system_id = None): self.__system_id = system_id self.__public_id = None self.__encoding = None self.__bytefile = None self.__charfile = None def setPublicId(self, public_id): "Sets the public identifier of this InputSource." self.__public_id = public_id def getPublicId(self): "Returns the public identifier of this InputSource." return self.__public_id def setSystemId(self, system_id): "Sets the system identifier of this InputSource." self.__system_id = system_id def getSystemId(self): "Returns the system identifier of this InputSource." return self.__system_id def setEncoding(self, encoding): """Sets the character encoding of this InputSource. The encoding must be a string acceptable for an XML encoding declaration (see section 4.3.3 of the XML recommendation). The encoding attribute of the InputSource is ignored if the InputSource also contains a character stream.""" self.__encoding = encoding def getEncoding(self): "Get the character encoding of this InputSource." return self.__encoding def setByteStream(self, bytefile): """Set the byte stream (a Python file-like object which does not perform byte-to-character conversion) for this input source. The SAX parser will ignore this if there is also a character stream specified, but it will use a byte stream in preference to opening a URI connection itself. If the application knows the character encoding of the byte stream, it should set it with the setEncoding method.""" self.__bytefile = bytefile def getByteStream(self): """Get the byte stream for this input source. The getEncoding method will return the character encoding for this byte stream, or None if unknown.""" return self.__bytefile def setCharacterStream(self, charfile): """Set the character stream for this input source. (The stream must be a Python 2.0 Unicode-wrapped file-like that performs conversion to Unicode strings.) If there is a character stream specified, the SAX parser will ignore any byte stream and will not attempt to open a URI connection to the system identifier.""" self.__charfile = charfile def getCharacterStream(self): "Get the character stream for this input source." return self.__charfile # ===== ATTRIBUTESIMPL ===== class AttributesImpl: def __init__(self, attrs): """Non-NS-aware implementation. attrs should be of the form {name : value}.""" self._attrs = attrs def getLength(self): return len(self._attrs) def getType(self, name): return "CDATA" def getValue(self, name): return self._attrs[name] def getValueByQName(self, name): return self._attrs[name] def getNameByQName(self, name): if name not in self._attrs: raise KeyError(name) return name def getQNameByName(self, name): if name not in self._attrs: raise KeyError(name) return name def getNames(self): return list(self._attrs.keys()) def getQNames(self): return list(self._attrs.keys()) def __len__(self): return len(self._attrs) def __getitem__(self, name): return self._attrs[name] def keys(self): return list(self._attrs.keys()) def __contains__(self, name): return name in self._attrs def get(self, name, alternative=None): return self._attrs.get(name, alternative) def copy(self): return self.__class__(self._attrs) def items(self): return list(self._attrs.items()) def values(self): return list(self._attrs.values()) # ===== ATTRIBUTESNSIMPL ===== class AttributesNSImpl(AttributesImpl): def __init__(self, attrs, qnames): """NS-aware implementation. attrs should be of the form {(ns_uri, lname): value, ...}. qnames of the form {(ns_uri, lname): qname, ...}.""" self._attrs = attrs self._qnames = qnames def getValueByQName(self, name): for (nsname, qname) in self._qnames.items(): if qname == name: return self._attrs[nsname] raise KeyError(name) def getNameByQName(self, name): for (nsname, qname) in self._qnames.items(): if qname == name: return nsname raise KeyError(name) def getQNameByName(self, name): return self._qnames[name] def getQNames(self): return list(self._qnames.values()) def copy(self): return self.__class__(self._attrs, self._qnames) def _test(): XMLReader() IncrementalParser() Locator() if __name__ == "__main__": _test() PKN\oQQ/sax/__pycache__/xmlreader.cpython-311.opt-1.pycnu[ !A?h1dZddlmZddlmZmZGddZGddeZGdd ZGd d Z Gd d Z Gdde Z dZ e dkr e dSdS)z]An XML Reader is the SAX 2 name for an XML parser. XML Parsers should be based on this code. )handler)SAXNotSupportedExceptionSAXNotRecognizedExceptioncleZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdZdS) XMLReadera%Interface for reading an XML document using callbacks. XMLReader is the interface that an XML parser's SAX2 driver must implement. This interface allows an application to set and query features and properties in the parser, to register event handlers for document processing, and to initiate a document parse. All SAX interfaces are assumed to be synchronous: the parse methods must not return until parsing is complete, and readers must wait for an event-handler callback to return before reporting the next event.ctj|_tj|_tj|_tj|_dSN) rContentHandler _cont_handler DTDHandler _dtd_handlerEntityResolver _ent_handler ErrorHandler _err_handlerselfs >/opt/alt/python-internal/lib64/python3.11/xml/sax/xmlreader.py__init__zXMLReader.__init__sL$355#.00#244#022c td)zAParse an XML document from a system identifier or an InputSource. This method must be implemented!NotImplementedErrorrsources rparsezXMLReader.parses!"DEEErc|jS)z#Returns the current ContentHandler.r rs rgetContentHandlerzXMLReader.getContentHandler"s !!rc||_dS)z:Registers a new object to receive document content events.Nrrrs rsetContentHandlerzXMLReader.setContentHandler&s$rc|jS)z Returns the current DTD handler.r rs r getDTDHandlerzXMLReader.getDTDHandler*   rc||_dS)z7Register an object to receive basic DTD-related events.Nr%r"s r setDTDHandlerzXMLReader.setDTDHandler.#rc|jS)z#Returns the current EntityResolver.rrs rgetEntityResolverzXMLReader.getEntityResolver2r'rc||_dS)z0Register an object to resolve external entities.Nr,)rresolvers rsetEntityResolverzXMLReader.setEntityResolver6s$rc|jS)z!Returns the current ErrorHandler.rrs rgetErrorHandlerzXMLReader.getErrorHandler:r'rc||_dS)z3Register an object to receive error-message events.Nr2r"s rsetErrorHandlerzXMLReader.setErrorHandler>r*rc td)aHAllow an application to set the locale for errors and warnings. SAX parsers are not required to provide localization for errors and warnings; if they cannot support the requested locale, however, they must raise a SAX exception. Applications may request a locale change in the middle of a parse.zLocale support not implemented)r)rlocales r setLocalezXMLReader.setLocaleBs''GHHHrc&td|z)z1Looks up and returns the state of a SAX2 feature.Feature '%s' not recognizedrrnames r getFeaturezXMLReader.getFeatureK'(E(LMMMrc&td|z)z!Sets the state of a SAX2 feature.r:r;)rr=states r setFeaturezXMLReader.setFeatureOr?rc&td|z)z2Looks up and returns the value of a SAX2 property.Property '%s' not recognizedr;r<s r getPropertyzXMLReader.getPropertyS'(F(MNNNrc&td|z)z"Sets the value of a SAX2 property.rDr;)rr=values r setPropertyzXMLReader.setPropertyWrFrN)__name__ __module__ __qualname____doc__rrr r#r&r)r-r0r3r5r8r>rBrErIrrrr s  333 FFF"""%%%!!!$$$!!!%%%!!!$$$IIINNNNNNOOOOOOOOrrc8eZdZdZd dZdZdZdZdZdZ d S) IncrementalParserasThis interface adds three extra methods to the XMLReader interface that allow XML parsers to support incremental parsing. Support for this interface is optional, since not all underlying XML parsers support this functionality. When the parser is instantiated it is ready to begin accepting data from the feed method immediately. After parsing has been finished with a call to close the reset method must be called to make the parser ready to accept new data, either from feed or using the parse method. Note that these methods must _not_ be called during parsing, that is, after parse has been called and before it returns. By default, the class also implements the parse method of the XMLReader interface using the feed, close and reset methods of the IncrementalParser interface as a convenience to SAX 2.0 driver writers.cH||_t|dSr )_bufsizerr)rbufsizes rrzIncrementalParser.__init__os# 4     rc|ddlm}||}|||}||}||j}|r1||||j}|1| dS)Nr)saxutils) rVprepare_input_source prepareParsergetCharacterStream getByteStreamreadrSfeedclose)rrrVfilebuffers rrzIncrementalParser.parsess..v66 6"""((** <''))D4=)) . IIf   YYt}--F . rc td)aThis method gives the raw XML data in the data parameter to the parser and makes it parse the data, emitting the corresponding events. It is allowed for XML constructs to be split across several calls to feed. feed may raise SAXException.rr)rdatas rr]zIncrementalParser.feeds""DEEErc td)ztThis method is called by the parse implementation to allow the SAX 2.0 driver to prepare itself for parsing.z!prepareParser must be overridden!rrs rrYzIncrementalParser.prepareParsers""EFFFrc td)aThis method is called when the entire XML document has been passed to the parser through the feed method, to notify the parser that there are no more data. This allows the parser to do the final checks on the document and empty the internal data buffer. The parser will not be ready to parse another document until the reset method has been called. close may raise SAXException.rrrs rr^zIncrementalParser.closes""DEEErc td)zThis method is called after close has been called to reset the parser so that it is ready to parse new documents. The results of calling parse or feed after close without calling reset are undefined.rrrs rresetzIncrementalParser.resets ""DEEErN)rQ) rJrKrLrMrrr]rYr^rfrNrrrPrP[s&!!!!   FFFGGG F F FFFFFFrrPc*eZdZdZdZdZdZdZdS)LocatorzInterface for associating a SAX event with a document location. A locator object will return valid results only during calls to DocumentHandler methods; at any other time, the results are unpredictable.cdS)z6Return the column number where the current event ends.rNrs rgetColumnNumberzLocator.getColumnNumberrrcdS)z4Return the line number where the current event ends.rjrNrs r getLineNumberzLocator.getLineNumberrlrcdS)z3Return the public identifier for the current event.NrNrs r getPublicIdzLocator.getPublicIdtrcdS)z3Return the system identifier for the current event.NrNrs r getSystemIdzLocator.getSystemIdrqrN)rJrKrLrMrkrnrprsrNrrrhrhsZ"" rrhcVeZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdS) InputSourceanEncapsulation of the information needed by the XMLReader to read entities. This class may include information about the public identifier, system identifier, byte stream (possibly with character encoding information) and/or the character stream of an entity. Applications will create objects of this class for use in the XMLReader.parse method and for returning from EntityResolver.resolveEntity. An InputSource belongs to the application, the XMLReader is not allowed to modify InputSource objects passed to it from the application, although it may make copies and modify those.NcL||_d|_d|_d|_d|_dSr )_InputSource__system_id_InputSource__public_id_InputSource__encoding_InputSource__bytefile_InputSource__charfiler system_ids rrzInputSource.__init__s+$rc||_dS)z/Sets the public identifier of this InputSource.Nrx)r public_ids r setPublicIdzInputSource.setPublicId$rc|jS)z2Returns the public identifier of this InputSource.rrs rrpzInputSource.getPublicId rc||_dS)z/Sets the system identifier of this InputSource.Nrwr|s r setSystemIdzInputSource.setSystemIdrrc|jS)z2Returns the system identifier of this InputSource.rrs rrszInputSource.getSystemIdrrc||_dS)a4Sets the character encoding of this InputSource. The encoding must be a string acceptable for an XML encoding declaration (see section 4.3.3 of the XML recommendation). The encoding attribute of the InputSource is ignored if the InputSource also contains a character stream.Nry)rencodings r setEncodingzInputSource.setEncoding#rc|jS)z/Get the character encoding of this InputSource.rrs r getEncodingzInputSource.getEncoding rc||_dS)aSet the byte stream (a Python file-like object which does not perform byte-to-character conversion) for this input source. The SAX parser will ignore this if there is also a character stream specified, but it will use a byte stream in preference to opening a URI connection itself. If the application knows the character encoding of the byte stream, it should set it with the setEncoding method.Nrz)rbytefiles r setByteStreamzInputSource.setByteStreams#rc|jS)zGet the byte stream for this input source. The getEncoding method will return the character encoding for this byte stream, or None if unknown.rrs rr[zInputSource.getByteStreams rc||_dS)a^Set the character stream for this input source. (The stream must be a Python 2.0 Unicode-wrapped file-like that performs conversion to Unicode strings.) If there is a character stream specified, the SAX parser will ignore any byte stream and will not attempt to open a URI connection to the system identifier.Nr{)rcharfiles rsetCharacterStreamzInputSource.setCharacterStreamrrc|jS)z/Get the character stream for this input source.rrs rrZzInputSource.getCharacterStreamrrr )rJrKrLrMrrrprrsrrrr[rrZrNrrrurus B B    %%%   %%%   ### # # ####rrucveZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZddZdZdZdZdS)AttributesImplc||_dS)zQNon-NS-aware implementation. attrs should be of the form {name : value}.N_attrs)rattrss rrzAttributesImpl.__init__s rc*t|jSr lenrrs r getLengthzAttributesImpl.getLength4;rcdS)NCDATArNr<s rgetTypezAttributesImpl.getType!swrc|j|Sr rr<s rgetValuezAttributesImpl.getValue${4  rc|j|Sr rr<s rgetValueByQNamezAttributesImpl.getValueByQName'rrc6||jvrt||Sr rKeyErrorr<s rgetNameByQNamezAttributesImpl.getNameByQName* t{ " "4..  rc6||jvrt||Sr rr<s rgetQNameByNamezAttributesImpl.getQNameByName/rrcNt|jSr listrkeysrs rgetNameszAttributesImpl.getNames4DK$$&&'''rcNt|jSr rrs r getQNameszAttributesImpl.getQNames7rrc*t|jSr rrs r__len__zAttributesImpl.__len__:rrc|j|Sr rr<s r __getitem__zAttributesImpl.__getitem__=rrcNt|jSr rrs rrzAttributesImpl.keys@rrc||jvSr rr<s r __contains__zAttributesImpl.__contains__Cst{""rNc8|j||Sr )rget)rr= alternatives rrzAttributesImpl.getFs{t[111rc6||jSr ) __class__rrs rcopyzAttributesImpl.copyIs~~dk***rcNt|jSr )rritemsrs rrzAttributesImpl.itemsLsDK%%''(((rcNt|jSr )rrvaluesrs rrzAttributesImpl.valuesOsDK&&(()))rr )rJrKrLrrrrrrrrrrrrrrrrrrNrrrrs    !!!!!!  ((((((   !!!(((###2222+++)))*****rrc2eZdZdZdZdZdZdZdZdS)AttributesNSImplc"||_||_dS)zNS-aware implementation. attrs should be of the form {(ns_uri, lname): value, ...}. qnames of the form {(ns_uri, lname): qname, ...}.N)r_qnames)rrqnamess rrzAttributesNSImpl.__init__Vs   rc|jD]\}}||kr|j|cSt|r )rrrrrr=nsnameqnames rrz AttributesNSImpl.getValueByQName^sR#|1133 + +OVU}}{6****tnnrcr|jD]\}}||kr|cSt|r )rrrrs rrzAttributesNSImpl.getNameByQNameesH#|1133  OVU}} tnnrc|j|Sr )rr<s rrzAttributesNSImpl.getQNameByNamels|D!!rcNt|jSr )rrrrs rrzAttributesNSImpl.getQNamesosDL''))***rcB||j|jSr )rrrrs rrzAttributesNSImpl.copyrs~~dk4<888rN) rJrKrLrrrrrrrNrrrrTsn"""+++99999rrcZtttdSr )rrPrhrNrr_testrvs$ KKK IIIIIr__main__N)rMrWr _exceptionsrrrrPrhrurrrrJrNrrrs""LLLLLLLL NONONONONONONONO`FFFFFFFFFF FFFFFFT0UUUUUUUUr:*:*:*:*:*:*:*:*|99999~999D  z EGGGGGrPKN\hSYSY+sax/__pycache__/expatreader.cpython-311.pycnu[ !A?hS? dZdZddlTddlmZmZddlmZddlmZmZddlm Z ddlm Z m Z dd l Z e j d d d kr ed d [ dd lmZeeds edd n#e$r edd wxYwddlmZmZmZejZejZ dd lZdd lZejZ[[n#e$rdZYnwxYwGddZGddejZGddej ejZ!dZ"e#dkrdd l$Z%e"Z&e&'e%j(j)e&*e%j(+e&,dd Sd S)z] SAX driver for the pyexpat C module. This driver works with pyexpat.__version__ == '2.22'. z0.20)*)feature_validationfeature_namespaces)feature_namespace_prefixes)feature_external_gesfeature_external_pes)feature_string_interning)property_xml_stringproperty_interning_dictNjavazexpat not available in Java)expat ParserCreatezexpat not supported) xmlreadersaxutilshandlerc|SN)os @/opt/alt/python-internal/lib64/python3.11/xml/sax/expatreader.py_mkproxyr'sceZdZdS) _ClosedParserN)__name__ __module__ __qualname__rrrrr.sDrrc0eZdZdZdZdZdZdZdZdS) ExpatLocatorzLocator for use with the ExpatParser class. This uses a weak reference to the parser object to avoid creating a circular reference between the parser and the content handler. c.t||_dSr)r_refselfparsers r__init__zExpatLocator.__init__9sV$$ rc:|j}|jdS|jjSr)r"_parserErrorColumnNumberr#s rgetColumnNumberzExpatLocator.getColumnNumber<s! > !4~//rc:|j}|jdS|jjSN)r"r(ErrorLineNumberr#s r getLineNumberzExpatLocator.getLineNumberBs! > !1~--rcJ|j}|dS|jSr)r"_source getPublicIdr#s rr2zExpatLocator.getPublicIdH' >4~))+++rcJ|j}|dS|jSr)r"r1 getSystemIdr#s rr5zExpatLocator.getSystemIdNr3rN) rrr__doc__r&r*r/r2r5rrrr r 3si %%%000 ... ,,, ,,,,,rr ceZdZdZd&dZdZdZdZdZd Z d Z d Z d'd Z dZ dZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZd Zd!Z d"Z!d#Z"d$Z#d%S)( ExpatParserz$SAX driver for the pyexpat C module.rctj||tj|_d|_||_d|_d|_g|_ d|_ d|_ dS)NFr) rIncrementalParserr& InputSourcer1r( _namespaces_lex_handler_prop_parsing _entity_stack _external_ges _interning)r$namespaceHandlingbufsizes rr&zExpatParser.__init__Zsd#,,T7;;; ,..  ,!% rc(tj|}||_ ||jt |tj ||dS#| xYw)z3Parse an XML document from a URL or an InputSource.N) rprepare_input_sourcer1reset _cont_handlersetDocumentLocatorr rr;parse _close_sourcer$sources rrJzExpatParser.parsegs.v66   JJLLL   1 1,t2D2D E E E  ' - -dF ; ; ; ; ;     s AA::Bc|.|j|dSdSr)r5r(SetBaserLs r prepareParserzExpatParser.prepareParserwsD      + L !3!3!5!5 6 6 6 6 6 , +rctj|||jr|dSdSr)rr;setContentHandlerr?_reset_cont_handler)r$rs rrRzExpatParser.setContentHandler}sG#55dGDDD = '  $ $ & & & & & ' 'rc|tkr|jS|tkr |jduS|tt t fvrdS|tkr|jStd|z)NrFeature '%s' not recognized) rr=r rBrrrrrASAXNotRecognizedExceptionr$names r getFeaturezExpatParser.getFeaturesy % % %# # - - -?$. . (*>02221 ) ) )% %'(E(LMMMrc|jrtd|tkr ||_dS|tkr ||_dS|t kr|r|j i|_dSdSd|_dS|tkr|rtddS|tkr|rtddS|tkr|rtddStd|z)Nz!Cannot set features while parsingz!expat does not support validationz/expat does not read external parameter entitiesz(expat does not report namespace prefixesrU) r?SAXNotSupportedExceptionrr=rrAr rBrrrrV)r$rXstates r setFeaturezExpatParser.setFeaturesQ = P*+NOO O % % %$D    ) ) )!&D    - - - '?*&(DOOO+*#' ' ' ' 9.7999 9 9) ) ) G.EGGG G G/ / / @.>@@@ @ @,-466 6rc4|tjkr|jS|tkr|jS|t krS|jr=t|jdr|jStdtdtd|z)NGetInputContextz=This version of expat does not support getting the XML stringz.XML string cannot be returned when not parsingProperty '%s' not recognized) rproperty_lexical_handlerr>r rBr r(hasattrr_rVr[rWs r getPropertyzExpatParser.getPropertys 73 3 3) ) , , ,? " ( ( (| F4<):;;+<779993*+++/DFFF'(F(MNNNrc|tjkr&||_|jr|dSdS|t kr ||_dS|tkrtd|ztd|z)NzProperty '%s' cannot be setr`) rrar>r?_reset_lex_handler_propr rBr r[rV)r$rXvalues r setPropertyzExpatParser.setPropertys 73 3 3%*D "} /,,..... / / , , ,#DOOO ( ( (*+H+/,011 1,,J,0-122 2rFcr|js4|d|_|j |j||dS#t j$rM}tt j |j ||}|j |Yd}~dSd}~wwxYw)NT) r?rGrH startDocumentr(ParsererrorSAXParseException ErrorStringcode _err_handler fatalError)r$dataisFinaleexcs rfeedzExpatParser.feeds} / JJLLL DM   , , . . . . L  tW - - - - -{ . . .#E$5af$=$=q$GGC   ( ( - - - - - - - - - .sAB6)AB11B6c|jdS|j} |jd|jddn^#tj$rL}t t j|j||}|j |Yd}~nd}~wwxYw|j|dS#|j|wxYw)NFr) r(GetReparseDeferralEnabledSetReparseDeferralEnabledrjrrkrlrmrnrorp)r$ was_enabledrsrts rflushzExpatParser.flushs <  Fl<<>>  @ L 2 25 9 9 9 L  sE * * * *{ . . .#E$5af$=$=q$GGC   ( ( - - - - - - - - . L 2 2; ? ? ? ? ?DL 2 2; ? ? ? ?s05ACB5)AB0+C0B55CC0c"|j} |}|||}||dSdS#|}||wwxYwr)r1getCharacterStreamclose getByteStream)r$rMfiles rrKzExpatParser._close_sources ,,..D ''))D  ''))D  s *A!!-BcF|js!|jt|jtrdS |dd|jd|_d|_d|_|j7t}|jj|_|jj |_ ||_| dS#d|_|j7t}|jj|_|jj |_ ||_| wxYw)NrT)rrF) r@r( isinstancerrurH endDocumentr?r)r.rKr#s rr}zExpatParser.closes   $,"6 t|] 3 3#7 F ! IIc4I ( ( (   * * , , ,!DMDL!DM|'&+/<+I()-)E&%    "DM|'&+/<+I()-)E&%    s >CAD c^|jj|j_|jj|j_dSr)rHprocessingInstructionr(ProcessingInstructionHandler charactersCharacterDataHandlerr$s rrSzExpatParser._reset_cont_handler s+$($6$L 1,0,>,I )))rc|j}|j}|%d|_d|_d|_d|_d|_dS|j|_|j|_|j |_|j |_|j |_dSr) r>r(CommentHandlerStartCdataSectionHandlerEndCdataSectionHandlerStartDoctypeDeclHandlerEndDoctypeDeclHandlercomment startCDATAendCDATAstart_doctype_declendDTD)r$lexr%s rrez#ExpatParser._reset_lex_handler_props}$ ;$(F !.2F +,0F )-1F *+/F ( ( ($'KF !.1nF +,/LF )-1-DF *+.:F ( ( (rcT|jrgtj|jd|j|_d|j_|j|j_ |j |j_ nYtj|j|j|_|j |j_ |j |j_ ||j|j_|j|j_|j|j_|j|j_d|_|jr||j|j_ |j|j_n#t<$rYnwxYw|jtj d|_!g|_"dS)N )internr-F)#r=rrr1 getEncodingrBr(namespace_prefixesstart_element_nsStartElementHandlerend_element_nsEndElementHandler start_element end_elementrSunparsed_entity_declUnparsedEntityDeclHandler notation_declNotationDeclHandlerstart_namespace_declStartNamespaceDeclHandlerend_namespace_declEndNamespaceDeclHandler_decl_handler_propr>reexternal_entity_refExternalEntityRefHandlerskipped_entity_handlerSkippedEntityHandlerAttributeErrorSetParamEntityParsing*XML_PARAM_ENTITY_PARSING_UNLESS_STANDALONEr?r@rs rrGzExpatParser.reset"s   > -dl.F.F.H.H#59_FFFDL./DL +/3/DDL ,-1-@DL * * -dl.F.F.H.H7;HHHDL/3/ADL ,-1-=DL *   """151J .+/+= (151J ./3/F ,"&  ! +  ( ( * * *150H - 040KDL - -    D  **  < > > > sE&& E32E3c,|jdS|jjSr)r(r)rs rr*zExpatParser.getColumnNumberIs < 4|--rc,|jdS|jjSr,)r(r.rs rr/zExpatParser.getLineNumberNs < 1|++rc4|jSr)r1r2rs rr2zExpatParser.getPublicIdS|'')))rc4|jSr)r1r5rs rr5zExpatParser.getSystemIdVrrcV|j|t|dSr)rH startElementAttributesImpl)r$rXattrss rrzExpatParser.start_elementZs) ''nU.C.CDDDDDrc:|j|dSr)rH endElementrWs rrzExpatParser.end_element] %%d+++++rcJ|}t|dkrd|f}n3t|dkr|d|df}nt|}i}i}|D]\}}|}t|} | dkr|} d|f} nA| dkr$|dd|d} |d|df} n|d} t|} ||| <| || <|j|dt ||dS)Nr-r:)splitlentupleitemsrHstartElementNSAttributesNSImpl) r$rXrpairnewattrsqnamesanamerfpartslengthqnameapairs rrzExpatParser.start_element_ns`sIzz|| t99>>$
>$
>>>>rc:|j|dSr)rHr)r$rqs rcharacter_datazExpatParser.character_datarrc<|j||dSr)rHstartPrefixMapping)r$prefixuris rrz ExpatParser.start_namespace_decls! --fc:::::rc:|j|dSr)rHendPrefixMapping)r$rs rrzExpatParser.end_namespace_decls ++F33333rc>|j|||dSr)r>startDTD)r$rXsysidpubidhas_internal_subsets rrzExpatParser.start_doctype_decls# ''eU;;;;;rc@|j||||dSr) _dtd_handlerunparsedEntityDecl)r$rXbaserr notation_names rrz ExpatParser.unparsed_entity_decls% ,,T5%OOOOOrc>|j|||dSr)r notationDecl)r$rXrrrs rrzExpatParser.notation_decls# &&tUE:::::rc|jsdS|j||}tj||jpd}|j|j |jf|j ||_ ||_ tj ||n#YdSxYw|jd\|_ |_|jd=dS)Nr-r)rA _ent_handler resolveEntityrrFr1r5r@appendr(ExternalEntityParserCreaterr;rJ)r$contextrrrrMs rrzExpatParser.external_entity_refs! 1"00>>.v/3|/G/G/I/I02/133 !!4<">???|>>wGG     ' - -dF ; ; ; ; 11'+'9"'=$t|  r "qs CCcH|rd|z}|j|dS)N%)rH skippedEntity)r$rXis_pes rrz"ExpatParser.skipped_entity_handlers0  t8D ((.....rN)rr9)F)$rrrr6r&rJrPrRrYr]rcrgrurzrKr}rSrerGr*r/r2r5rrrrrrrrrrrrrrrrr8r8Ws..     777 ''' N N N666<OOO$ 2 2 2 ...." @ @ @   !!!*JJJ 666 # # # N... ,,, ******EEE,,, N N ND 4 4 4???,,,;;;444<<<PPP;;;,/////rr8ct|i|Sr)r8)argskwargss r create_parserrs  ' ' ''r__main__z:http://www.ibiblio.org/xml/examples/shakespeare/hamlet.xml)-r6versionxml.sax._exceptionsxml.sax.handlerrrrrrr r r sysplatformSAXReaderNotAvailable xml.parsersrrb ImportErrorxml.saxrrrrr_weakrefweakrefproxyrrLocatorr r;r8rrxml.sax.saxutilsxmlprRsax XMLGeneratorsetErrorHandler ErrorHandlerrJrrrr s !!!!BBBBBBBB666666FFFFFFFF444444HHHHHHHH <v   =t D DDA!!!!!! 75. ) )A##$94@@@A===   5t < <<= 1000000000)- OOO NNN}H         ,,,,,9$,,,Hg/g/g/g/g/)-y/@g/g/g/V (((  z A(5577888cg**,,---GG HIIIII sA11BB11B<;B<PKN\00+sax/__pycache__/_exceptions.cpython-311.pycnu[ !A?hdZddlZejdddkrddlmZ[GddeZGdd eZGd d eZGd d eZGddeZ dS)z!Different kinds of SAX ExceptionsNjava) Exceptionc2eZdZdZddZdZdZdZdZdS) SAXExceptionaEncapsulate an XML error or warning. This class can contain basic error or warning information from either the XML parser or the application: you can subclass it to provide additional functionality, or to add localization. Note that although you will receive a SAXException as the argument to the handlers in the ErrorHandler interface, you are not actually required to raise the exception; instead, you can simply read the information in it.NcL||_||_tj||dS)zUCreates an exception. The message is required, but the exception is optional.N)_msg _exceptionr__init__)selfmsg exceptions @/opt/alt/python-internal/lib64/python3.11/xml/sax/_exceptions.pyr zSAXException.__init__s+ #4%%%%%c|jS)z$Return a message for this exception.r r s r getMessagezSAXException.getMessage yrc|jS)z9Return the embedded exception, or None if there was none.)r rs r getExceptionzSAXException.getExceptions rc|jS)0Create a string representation of the exception.rrs r__str__zSAXException.__str__"rrc td)zvAvoids weird error messages if someone does exception[ix] by mistake, since Exception has __getitem__ defined. __getitem__)AttributeError)r ixs rrzSAXException.__getitem__&s]+++r)N) __name__ __module__ __qualname____doc__r rrrrrrrr sn  &&&&,,,,,rrc6eZdZdZdZdZdZdZdZdZ dS) SAXParseExceptiona#Encapsulate an XML parse error or warning. This exception will include information for locating the error in the original XML document. Note that although the application will receive a SAXParseException as the argument to the handlers in the ErrorHandler interface, the application is not actually required to raise the exception; instead, it can simply read the information in it and take a different action. Since this exception is a subclass of SAXException, it inherits the ability to wrap another exception.ct|||||_|j|_|j|_|j|_dS)zECreates the exception. The exception parameter is allowed to be None.N) rr _locator getSystemId _systemIdgetColumnNumber_colnum getLineNumber_linenum)r r rlocators rr zSAXParseException.__init__;sfdC333 2244}4466  3355 rc|jS)zNThe column number of the end of the text where the exception occurred.)r+rs rr*z!SAXParseException.getColumnNumberHs |rc|jS)zDThe line number of the end of the text where the exception occurred.)r-rs rr,zSAXParseException.getLineNumberMs }rc4|jS)zEGet the public identifier of the entity where the exception occurred.)r' getPublicIdrs rr2zSAXParseException.getPublicIdQs}((***rc|jS)zEGet the system identifier of the entity where the exception occurred.)r)rs rr(zSAXParseException.getSystemIdUs ~rc|}|d}|}|d}|}|d}|d|d|d|jS)rNz ?:z: )r(r,r*r )r sysidlinenumcolnums rrzSAXParseException.__str__Ysr  "" =E$$&& ?G%%'' >F!&CCrN) rr r!r"r r*r,r2r(rr#rrr%r%.s} . . 6 6 6 +++ D D D D Drr%ceZdZdZdS)SAXNotRecognizedExceptionzException class for an unrecognized identifier. An XMLReader will raise this exception when it is confronted with an unrecognized feature or property. SAX applications and extensions may use this class for similar purposes.Nrr r!r"r#rrr;r;is,,,,rr;ceZdZdZdS)SAXNotSupportedExceptionaException class for an unsupported operation. An XMLReader will raise this exception when a service it cannot perform is requested (specifically setting a state or value). SAX applications and extensions may use this class for similar purposes.Nr<r#rrr>r>ssrr>ceZdZdZdS)SAXReaderNotAvailableaException class for a missing driver. An XMLReader module (driver) should raise this exception when it is first imported, e.g. when a support module cannot be imported. It also may be raised during parsing, e.g. if executing an external program is not permitted.Nr<r#rrr@r@}s!!!!rr@) r"sysplatform java.langrrr%r;r>r@r#rrrDs&'' <v###### , , , , ,9 , , ,J6D6D6D6D6D 6D6D6Dv,,,,, ,,,|!!!!!4!!!!!rPKN\x.sax/__pycache__/__init__.cpython-311.opt-2.pycnu[ !A?h: ddlmZddlmZmZddlmZmZmZm Z m Z efdZ efdZ dgZ dZerddlZddlZddlZejjs)d ejvr ejd d Z [d Zejdd d krGejer-ejed Z ddZejdd d krdZndZ[dS)) InputSource)ContentHandler ErrorHandler) SAXExceptionSAXNotRecognizedExceptionSAXParseExceptionSAXNotSupportedExceptionSAXReaderNotAvailablect}||||||dS)N) make_parsersetContentHandlersetErrorHandlerparse)sourcehandler errorHandlerparsers =/opt/alt/python-internal/lib64/python3.11/xml/sax/__init__.pyrrsK ]]F W%%% <((( LLcddl}|t}t}||||t }t |tr)|| |n(| | || |dS)N) iorr r rr isinstancestrsetCharacterStreamStringIO setByteStreamBytesIOr)stringrrrrinpsrcs r parseStringr!#s III#~~ ]]F W%%% <((( ]]F&#1!!"++f"5"56666RZZ//000 LLrzxml.sax.expatreaderrN PY_SAX_PARSER,zpython.xml.sax.parserjavac t|tzD]<} t|cS#t$rddl}||jvrY.t $rY9wxYwt dd)NrzNo parsers found)listdefault_parser_list_create_parser ImportErrorsysmodulesr ) parser_list parser_namer,s rr r FsJK((+>>    !+.. . . .    JJJck))*)%    D  2D 9 99s-A AAc|ddlm}||dt}|S)Nr)imp)org.python.corer1 importNameglobals create_parser)r/r1 drv_modules rr*r*as?''''''^^KGII>> '')))rcPt|iidg}|S)Nr5) __import__r5)r/r6s rr*r*gs* Br?2CDD '')))r)r&) xmlreaderrrrr _exceptionsrrrr r rr!r)_falsexml.sax.expatreaderxmlosr,flagsignore_environmentenvironsplit_keyplatformregistry containsKey getPropertyr r*r&rrrHs*#"""""11111111.............. )5  /;lnn    $--   y#A2:(E(E*_5;;C@@<v#,":":4"@"@,22488>>sCC::::4<1**** ***CCrPKN\w<<'sax/__pycache__/handler.cpython-311.pycnu[ !A?h=dZdZGddZGddZGddZGdd Zd Zd Zd Zd Z dZ dZ eeee e e gZ dZ dZdZdZdZdZe eeeeegZGddZdS)a0 This module contains the core classes of version 2.0 of SAX for Python. This file provides only default classes with absolutely minimum functionality, from which drivers and applications can be subclassed. Many of these classes are empty and are included only as documentation of the interfaces. $Id$ z2.0betac$eZdZdZdZdZdZdS) ErrorHandleraBasic interface for SAX error handlers. If you create an object that implements this interface, then register the object with your XMLReader, the parser will call the methods in your object to report all warnings and errors. There are three levels of errors available: warnings, (possibly) recoverable errors, and unrecoverable errors. All methods take a SAXParseException as the only parameter.c|)zHandle a recoverable error.self exceptions rns   2\\\\\\\\B 7 7 7 7 7 7 7 7        (> NJ > O Q#*("$$ & K S =A DP+#.%#) +*9*9*9*9*9*9*9*9*9*9r PKN\w<<-sax/__pycache__/handler.cpython-311.opt-1.pycnu[ !A?h=dZdZGddZGddZGddZGdd Zd Zd Zd Zd Z dZ dZ eeee e e gZ dZ dZdZdZdZdZe eeeeegZGddZdS)a0 This module contains the core classes of version 2.0 of SAX for Python. This file provides only default classes with absolutely minimum functionality, from which drivers and applications can be subclassed. Many of these classes are empty and are included only as documentation of the interfaces. $Id$ z2.0betac$eZdZdZdZdZdZdS) ErrorHandleraBasic interface for SAX error handlers. If you create an object that implements this interface, then register the object with your XMLReader, the parser will call the methods in your object to report all warnings and errors. There are three levels of errors available: warnings, (possibly) recoverable errors, and unrecoverable errors. All methods take a SAXParseException as the only parameter.c|)zHandle a recoverable error.self exceptions rns   2\\\\\\\\B 7 7 7 7 7 7 7 7        (> NJ > O Q#*("$$ & K S =A DP+#.%#) +*9*9*9*9*9*9*9*9*9*9r PKN\hSYSY1sax/__pycache__/expatreader.cpython-311.opt-1.pycnu[ !A?hS? dZdZddlTddlmZmZddlmZddlmZmZddlm Z ddlm Z m Z dd l Z e j d d d kr ed d [ dd lmZeeds edd n#e$r edd wxYwddlmZmZmZejZejZ dd lZdd lZejZ[[n#e$rdZYnwxYwGddZGddejZGddej ejZ!dZ"e#dkrdd l$Z%e"Z&e&'e%j(j)e&*e%j(+e&,dd Sd S)z] SAX driver for the pyexpat C module. This driver works with pyexpat.__version__ == '2.22'. z0.20)*)feature_validationfeature_namespaces)feature_namespace_prefixes)feature_external_gesfeature_external_pes)feature_string_interning)property_xml_stringproperty_interning_dictNjavazexpat not available in Java)expat ParserCreatezexpat not supported) xmlreadersaxutilshandlerc|SN)os @/opt/alt/python-internal/lib64/python3.11/xml/sax/expatreader.py_mkproxyr'sceZdZdS) _ClosedParserN)__name__ __module__ __qualname__rrrrr.sDrrc0eZdZdZdZdZdZdZdZdS) ExpatLocatorzLocator for use with the ExpatParser class. This uses a weak reference to the parser object to avoid creating a circular reference between the parser and the content handler. c.t||_dSr)r_refselfparsers r__init__zExpatLocator.__init__9sV$$ rc:|j}|jdS|jjSr)r"_parserErrorColumnNumberr#s rgetColumnNumberzExpatLocator.getColumnNumber<s! > !4~//rc:|j}|jdS|jjSN)r"r(ErrorLineNumberr#s r getLineNumberzExpatLocator.getLineNumberBs! > !1~--rcJ|j}|dS|jSr)r"_source getPublicIdr#s rr2zExpatLocator.getPublicIdH' >4~))+++rcJ|j}|dS|jSr)r"r1 getSystemIdr#s rr5zExpatLocator.getSystemIdNr3rN) rrr__doc__r&r*r/r2r5rrrr r 3si %%%000 ... ,,, ,,,,,rr ceZdZdZd&dZdZdZdZdZd Z d Z d Z d'd Z dZ dZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZd Zd!Z d"Z!d#Z"d$Z#d%S)( ExpatParserz$SAX driver for the pyexpat C module.rctj||tj|_d|_||_d|_d|_g|_ d|_ d|_ dS)NFr) rIncrementalParserr& InputSourcer1r( _namespaces_lex_handler_prop_parsing _entity_stack _external_ges _interning)r$namespaceHandlingbufsizes rr&zExpatParser.__init__Zsd#,,T7;;; ,..  ,!% rc(tj|}||_ ||jt |tj ||dS#| xYw)z3Parse an XML document from a URL or an InputSource.N) rprepare_input_sourcer1reset _cont_handlersetDocumentLocatorr rr;parse _close_sourcer$sources rrJzExpatParser.parsegs.v66   JJLLL   1 1,t2D2D E E E  ' - -dF ; ; ; ; ;     s AA::Bc|.|j|dSdSr)r5r(SetBaserLs r prepareParserzExpatParser.prepareParserwsD      + L !3!3!5!5 6 6 6 6 6 , +rctj|||jr|dSdSr)rr;setContentHandlerr?_reset_cont_handler)r$rs rrRzExpatParser.setContentHandler}sG#55dGDDD = '  $ $ & & & & & ' 'rc|tkr|jS|tkr |jduS|tt t fvrdS|tkr|jStd|z)NrFeature '%s' not recognized) rr=r rBrrrrrASAXNotRecognizedExceptionr$names r getFeaturezExpatParser.getFeaturesy % % %# # - - -?$. . (*>02221 ) ) )% %'(E(LMMMrc|jrtd|tkr ||_dS|tkr ||_dS|t kr|r|j i|_dSdSd|_dS|tkr|rtddS|tkr|rtddS|tkr|rtddStd|z)Nz!Cannot set features while parsingz!expat does not support validationz/expat does not read external parameter entitiesz(expat does not report namespace prefixesrU) r?SAXNotSupportedExceptionrr=rrAr rBrrrrV)r$rXstates r setFeaturezExpatParser.setFeaturesQ = P*+NOO O % % %$D    ) ) )!&D    - - - '?*&(DOOO+*#' ' ' ' 9.7999 9 9) ) ) G.EGGG G G/ / / @.>@@@ @ @,-466 6rc4|tjkr|jS|tkr|jS|t krS|jr=t|jdr|jStdtdtd|z)NGetInputContextz=This version of expat does not support getting the XML stringz.XML string cannot be returned when not parsingProperty '%s' not recognized) rproperty_lexical_handlerr>r rBr r(hasattrr_rVr[rWs r getPropertyzExpatParser.getPropertys 73 3 3) ) , , ,? " ( ( (| F4<):;;+<779993*+++/DFFF'(F(MNNNrc|tjkr&||_|jr|dSdS|t kr ||_dS|tkrtd|ztd|z)NzProperty '%s' cannot be setr`) rrar>r?_reset_lex_handler_propr rBr r[rV)r$rXvalues r setPropertyzExpatParser.setPropertys 73 3 3%*D "} /,,..... / / , , ,#DOOO ( ( (*+H+/,011 1,,J,0-122 2rFcr|js4|d|_|j |j||dS#t j$rM}tt j |j ||}|j |Yd}~dSd}~wwxYw)NT) r?rGrH startDocumentr(ParsererrorSAXParseException ErrorStringcode _err_handler fatalError)r$dataisFinaleexcs rfeedzExpatParser.feeds} / JJLLL DM   , , . . . . L  tW - - - - -{ . . .#E$5af$=$=q$GGC   ( ( - - - - - - - - - .sAB6)AB11B6c|jdS|j} |jd|jddn^#tj$rL}t t j|j||}|j |Yd}~nd}~wwxYw|j|dS#|j|wxYw)NFr) r(GetReparseDeferralEnabledSetReparseDeferralEnabledrjrrkrlrmrnrorp)r$ was_enabledrsrts rflushzExpatParser.flushs <  Fl<<>>  @ L 2 25 9 9 9 L  sE * * * *{ . . .#E$5af$=$=q$GGC   ( ( - - - - - - - - . L 2 2; ? ? ? ? ?DL 2 2; ? ? ? ?s05ACB5)AB0+C0B55CC0c"|j} |}|||}||dSdS#|}||wwxYwr)r1getCharacterStreamclose getByteStream)r$rMfiles rrKzExpatParser._close_sources ,,..D ''))D  ''))D  s *A!!-BcF|js!|jt|jtrdS |dd|jd|_d|_d|_|j7t}|jj|_|jj |_ ||_| dS#d|_|j7t}|jj|_|jj |_ ||_| wxYw)NrT)rrF) r@r( isinstancerrurH endDocumentr?r)r.rKr#s rr}zExpatParser.closes   $,"6 t|] 3 3#7 F ! IIc4I ( ( (   * * , , ,!DMDL!DM|'&+/<+I()-)E&%    "DM|'&+/<+I()-)E&%    s >CAD c^|jj|j_|jj|j_dSr)rHprocessingInstructionr(ProcessingInstructionHandler charactersCharacterDataHandlerr$s rrSzExpatParser._reset_cont_handler s+$($6$L 1,0,>,I )))rc|j}|j}|%d|_d|_d|_d|_d|_dS|j|_|j|_|j |_|j |_|j |_dSr) r>r(CommentHandlerStartCdataSectionHandlerEndCdataSectionHandlerStartDoctypeDeclHandlerEndDoctypeDeclHandlercomment startCDATAendCDATAstart_doctype_declendDTD)r$lexr%s rrez#ExpatParser._reset_lex_handler_props}$ ;$(F !.2F +,0F )-1F *+/F ( ( ($'KF !.1nF +,/LF )-1-DF *+.:F ( ( (rcT|jrgtj|jd|j|_d|j_|j|j_ |j |j_ nYtj|j|j|_|j |j_ |j |j_ ||j|j_|j|j_|j|j_|j|j_d|_|jr||j|j_ |j|j_n#t<$rYnwxYw|jtj d|_!g|_"dS)N )internr-F)#r=rrr1 getEncodingrBr(namespace_prefixesstart_element_nsStartElementHandlerend_element_nsEndElementHandler start_element end_elementrSunparsed_entity_declUnparsedEntityDeclHandler notation_declNotationDeclHandlerstart_namespace_declStartNamespaceDeclHandlerend_namespace_declEndNamespaceDeclHandler_decl_handler_propr>reexternal_entity_refExternalEntityRefHandlerskipped_entity_handlerSkippedEntityHandlerAttributeErrorSetParamEntityParsing*XML_PARAM_ENTITY_PARSING_UNLESS_STANDALONEr?r@rs rrGzExpatParser.reset"s   > -dl.F.F.H.H#59_FFFDL./DL +/3/DDL ,-1-@DL * * -dl.F.F.H.H7;HHHDL/3/ADL ,-1-=DL *   """151J .+/+= (151J ./3/F ,"&  ! +  ( ( * * *150H - 040KDL - -    D  **  < > > > sE&& E32E3c,|jdS|jjSr)r(r)rs rr*zExpatParser.getColumnNumberIs < 4|--rc,|jdS|jjSr,)r(r.rs rr/zExpatParser.getLineNumberNs < 1|++rc4|jSr)r1r2rs rr2zExpatParser.getPublicIdS|'')))rc4|jSr)r1r5rs rr5zExpatParser.getSystemIdVrrcV|j|t|dSr)rH startElementAttributesImpl)r$rXattrss rrzExpatParser.start_elementZs) ''nU.C.CDDDDDrc:|j|dSr)rH endElementrWs rrzExpatParser.end_element] %%d+++++rcJ|}t|dkrd|f}n3t|dkr|d|df}nt|}i}i}|D]\}}|}t|} | dkr|} d|f} nA| dkr$|dd|d} |d|df} n|d} t|} ||| <| || <|j|dt ||dS)Nr-r:)splitlentupleitemsrHstartElementNSAttributesNSImpl) r$rXrpairnewattrsqnamesanamerfpartslengthqnameapairs rrzExpatParser.start_element_ns`sIzz|| t99>>$
>$
>>>>rc:|j|dSr)rHr)r$rqs rcharacter_datazExpatParser.character_datarrc<|j||dSr)rHstartPrefixMapping)r$prefixuris rrz ExpatParser.start_namespace_decls! --fc:::::rc:|j|dSr)rHendPrefixMapping)r$rs rrzExpatParser.end_namespace_decls ++F33333rc>|j|||dSr)r>startDTD)r$rXsysidpubidhas_internal_subsets rrzExpatParser.start_doctype_decls# ''eU;;;;;rc@|j||||dSr) _dtd_handlerunparsedEntityDecl)r$rXbaserr notation_names rrz ExpatParser.unparsed_entity_decls% ,,T5%OOOOOrc>|j|||dSr)r notationDecl)r$rXrrrs rrzExpatParser.notation_decls# &&tUE:::::rc|jsdS|j||}tj||jpd}|j|j |jf|j ||_ ||_ tj ||n#YdSxYw|jd\|_ |_|jd=dS)Nr-r)rA _ent_handler resolveEntityrrFr1r5r@appendr(ExternalEntityParserCreaterr;rJ)r$contextrrrrMs rrzExpatParser.external_entity_refs! 1"00>>.v/3|/G/G/I/I02/133 !!4<">???|>>wGG     ' - -dF ; ; ; ; 11'+'9"'=$t|  r "qs CCcH|rd|z}|j|dS)N%)rH skippedEntity)r$rXis_pes rrz"ExpatParser.skipped_entity_handlers0  t8D ((.....rN)rr9)F)$rrrr6r&rJrPrRrYr]rcrgrurzrKr}rSrerGr*r/r2r5rrrrrrrrrrrrrrrrr8r8Ws..     777 ''' N N N666<OOO$ 2 2 2 ...." @ @ @   !!!*JJJ 666 # # # N... ,,, ******EEE,,, N N ND 4 4 4???,,,;;;444<<<PPP;;;,/////rr8ct|i|Sr)r8)argskwargss r create_parserrs  ' ' ''r__main__z:http://www.ibiblio.org/xml/examples/shakespeare/hamlet.xml)-r6versionxml.sax._exceptionsxml.sax.handlerrrrrrr r r sysplatformSAXReaderNotAvailable xml.parsersrrb ImportErrorxml.saxrrrrr_weakrefweakrefproxyrrLocatorr r;r8rrxml.sax.saxutilsxmlprRsax XMLGeneratorsetErrorHandler ErrorHandlerrJrrrr s !!!!BBBBBBBB666666FFFFFFFF444444HHHHHHHH <v   =t D DDA!!!!!! 75. ) )A##$94@@@A===   5t < <<= 1000000000)- OOO NNN}H         ,,,,,9$,,,Hg/g/g/g/g/)-y/@g/g/g/V (((  z A(5577888cg**,,---GG HIIIII sA11BB11B<;B<PKN\3c99/sax/__pycache__/xmlreader.cpython-311.opt-2.pycnu[ !A?h1 ddlmZddlmZmZGddZGddeZGddZGd d ZGd d Z Gd de Z dZ e dkr e dSdS))handler)SAXNotSupportedExceptionSAXNotRecognizedExceptioncjeZdZ dZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdS) XMLReaderctj|_tj|_tj|_tj|_dSN) rContentHandler _cont_handler DTDHandler _dtd_handlerEntityResolver _ent_handler ErrorHandler _err_handlerselfs >/opt/alt/python-internal/lib64/python3.11/xml/sax/xmlreader.py__init__zXMLReader.__init__sL$355#.00#244#022c" tdNz This method must be implemented!NotImplementedErrorrsources rparsezXMLReader.parsesK!"DEEErc |jSr r rs rgetContentHandlerzXMLReader.getContentHandler"s-!!rc ||_dSr rrrs rsetContentHandlerzXMLReader.setContentHandler&sD$rc |jSr r rs r getDTDHandlerzXMLReader.getDTDHandler*s*  rc ||_dSr r%r"s r setDTDHandlerzXMLReader.setDTDHandler.sA#rc |jSr rrs rgetEntityResolverzXMLReader.getEntityResolver2s-  rc ||_dSr r*)rresolvers rsetEntityResolverzXMLReader.setEntityResolver6s:$rc |jSr rrs rgetErrorHandlerzXMLReader.getErrorHandler:s+  rc ||_dSr r0r"s rsetErrorHandlerzXMLReader.setErrorHandler>s=#rc" td)NzLocale support not implemented)r)rlocales r setLocalezXMLReader.setLocaleBs = ''GHHHrc( td|zNzFeature '%s' not recognizedrrnames r getFeaturezXMLReader.getFeatureKs;'(E(LMMMrc( td|zr8r9)rr;states r setFeaturezXMLReader.setFeatureOs+'(E(LMMMrc( td|zNzProperty '%s' not recognizedr9r:s r getPropertyzXMLReader.getPropertySs<'(F(MNNNrc( td|zrAr9)rr;values r setPropertyzXMLReader.setPropertyWs,'(F(MNNNrN)__name__ __module__ __qualname__rrr r#r&r(r+r.r1r3r6r<r?rBrErrrr s 333 FFF"""%%%!!!$$$!!!%%%!!!$$$IIINNNNNNOOOOOOOOrrc6eZdZ d dZdZdZdZdZdZdS) IncrementalParsercH||_t|dSr )_bufsizerr)rbufsizes rrzIncrementalParser.__init__os# 4     rc|ddlm}||}|||}||}||j}|r1||||j}|1| dS)Nr)saxutils) rQprepare_input_source prepareParsergetCharacterStream getByteStreamreadrNfeedclose)rrrQfilebuffers rrzIncrementalParser.parsess..v66 6"""((** <''))D4=)) . IIf   YYt}--F . rc" tdrr)rdatas rrXzIncrementalParser.feeds ( ""DEEErc" td)Nz!prepareParser must be overridden!rrs rrTzIncrementalParser.prepareParsers =!"EFFFrc" tdrrrs rrYzIncrementalParser.closes )""DEEErc" tdrrrs rresetzIncrementalParser.resets ""DEEErN)rL) rFrGrHrrrXrTrYrarIrrrKrK[s&!!!!   FFFGGG F F FFFFFFrrKc(eZdZ dZdZdZdZdS)Locatorc dSNrIrs rgetColumnNumberzLocator.getColumnNumbers @rrc dSrerIrs r getLineNumberzLocator.getLineNumbers >rrc dSr rIrs r getPublicIdzLocator.getPublicId =trc dSr rIrs r getSystemIdzLocator.getSystemIdrlrN)rFrGrHrgrirkrnrIrrrcrcsU" rrccTeZdZ d dZdZdZdZdZdZdZ d Z d Z d Z d Z dS) InputSourceNcL||_d|_d|_d|_d|_dSr )_InputSource__system_id_InputSource__public_id_InputSource__encoding_InputSource__bytefile_InputSource__charfiler system_ids rrzInputSource.__init__s+$rc ||_dSr rs)r public_ids r setPublicIdzInputSource.setPublicId9$rc |jSr rzrs rrkzInputSource.getPublicId<rc ||_dSr rrrws r setSystemIdzInputSource.setSystemIdr}rc |jSr rrs rrnzInputSource.getSystemIdrrc ||_dSr rt)rencodings r setEncodingzInputSource.setEncodings 9#rc |jSr rrs r getEncodingzInputSource.getEncoding 9rc ||_dSr ru)rbytefiles r setByteStreamzInputSource.setByteStreams A#rc |jSr rrs rrVzInputSource.getByteStreams 1rc ||_dSr rv)rcharfiles rsetCharacterStreamzInputSource.setCharacterStreams 0#rc |jSr rrs rrUzInputSource.getCharacterStreamrrr )rFrGrHrr|rkrrnrrrrVrrUrIrrrprps B    %%%   %%%   ### # # ####rrpcveZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZddZdZdZdZdS)AttributesImplc ||_dSr _attrs)rattrss rrzAttributesImpl.__init__s 7 rc*t|jSr lenrrs r getLengthzAttributesImpl.getLength4;rcdS)NCDATArIr:s rgetTypezAttributesImpl.getType!swrc|j|Sr rr:s rgetValuezAttributesImpl.getValue${4  rc|j|Sr rr:s rgetValueByQNamezAttributesImpl.getValueByQName'rrc6||jvrt||Sr rKeyErrorr:s rgetNameByQNamezAttributesImpl.getNameByQName* t{ " "4..  rc6||jvrt||Sr rr:s rgetQNameByNamezAttributesImpl.getQNameByName/rrcNt|jSr listrkeysrs rgetNameszAttributesImpl.getNames4DK$$&&'''rcNt|jSr rrs r getQNameszAttributesImpl.getQNames7rrc*t|jSr rrs r__len__zAttributesImpl.__len__:rrc|j|Sr rr:s r __getitem__zAttributesImpl.__getitem__=rrcNt|jSr rrs rrzAttributesImpl.keys@rrc||jvSr rr:s r __contains__zAttributesImpl.__contains__Cst{""rNc8|j||Sr )rget)rr; alternatives rrzAttributesImpl.getFs{t[111rc6||jSr ) __class__rrs rcopyzAttributesImpl.copyIs~~dk***rcNt|jSr )rritemsrs rrzAttributesImpl.itemsLsDK%%''(((rcNt|jSr )rrvaluesrs rrzAttributesImpl.valuesOsDK&&(()))rr )rFrGrHrrrrrrrrrrrrrrrrrrIrrrrs    !!!!!!  ((((((   !!!(((###2222+++)))*****rrc2eZdZdZdZdZdZdZdZdS)AttributesNSImplc$ ||_||_dSr )r_qnames)rrqnamess rrzAttributesNSImpl.__init__Vs =  rc|jD]\}}||kr|j|cSt|r )rrrrrr;nsnameqnames rrz AttributesNSImpl.getValueByQName^sR#|1133 + +OVU}}{6****tnnrcr|jD]\}}||kr|cSt|r )rrrrs rrzAttributesNSImpl.getNameByQNameesH#|1133  OVU}} tnnrc|j|Sr )rr:s rrzAttributesNSImpl.getQNameByNamels|D!!rcNt|jSr )rrrrs rrzAttributesNSImpl.getQNamesosDL''))***rcB||j|jSr )rrrrs rrzAttributesNSImpl.copyrs~~dk4<888rN) rFrGrHrrrrrrrIrrrrTsn"""+++99999rrcZtttdSr )rrKrcrIrr_testrvs$ KKK IIIIIr__main__N) rRr _exceptionsrrrrKrcrprrrrFrIrrrs"LLLLLLLL NONONONONONONONO`FFFFFFFFFF FFFFFFT0UUUUUUUUr:*:*:*:*:*:*:*:*|99999~999D  z EGGGGGrPKN\祉 N N.sax/__pycache__/saxutils.cpython-311.opt-2.pycnu[ !A?h/ ddlZddlZddlZddlZddlZddlmZddlmZdZ ifdZ ifdZ ifdZ d Z Gd d ejZGd d ejZddZdS)N)handler) xmlreaderch |D]\}}|||}|SN)itemsreplace)sdkeyvalues =/opt/alt/python-internal/lib64/python3.11/xml/sax/saxutils.py__dict_replacer s:<ggii"" U IIc5 ! ! Hc |dd}|dd}|dd}|rt||}|S)N&&>><<r rdataentitiess rescapers^ <<W % %D <<V $ $D <<V $ $D.dH-- Krc |dd}|dd}|rt||}|ddS)Nrrrrrrrrs runescaper"sZ << $ $D << $ $D.dH-- << % %%rc i|dddd}t||}d|vr$d|vrd|ddz}n d |z}nd|z}|S) Nz z z )   "'z"%s"z"z'%s')rr rs r quoteattrr%0sw G(F'vFFFH $ ! !D d{{ $;;DLLh777DDD=DD} Krc ddl}|jSttjrStt jt jfrSttjr"Gfdd}|}d|_ nQtj }d|_ j |_ j |_ j|_n#t$rYnwxYwtj||ddd S) Nrc(eZdZjZfdZdS) _gettextwriter.._wrapperc$t|Sr)getattr)selfnameouts r __getattr__z,_gettextwriter.._wrapper.__getattr__ZssD)))rN)__name__ __module__ __qualname__ __class__r.)r-sr_wrapperr(Xs5 I * * * * * * *rr3cdSrr5rrz _gettextwriter..]strcdS)NTr5r5rrr6z _gettextwriter..bs$rxmlcharrefreplacer T)encodingerrorsnewline write_through)sysstdout isinstanceio TextIOBasecodecs StreamWriterStreamReaderWriter RawIOBasecloseBufferedIOBasewritablewriteseekabletellAttributeError TextIOWrapper)r-r9r=r3buffers` r_gettextwriterrOGs8 { z#r}%% #+V-FGHH #r|$$ * * * * * * * * * *#| "$$&,y  "lFO(FKK    D  FX#6$(*. 0 0 00s7C CCcfeZdZddZdZddZdZdZd Zd Z d Z d Z d Z dZ dZdZdZdS) XMLGeneratorN iso-8859-1Fctj|t||}|j|_|j|_ig|_|jd|_ g|_ ||_ ||_ d|_ dS)NF)rContentHandler__init__rOrI_writeflush_flush _ns_contexts_current_context_undeclared_ns_maps _encoding_short_empty_elements_pending_start_element)r+r-r9short_empty_elementss rrVzXMLGenerator.__init__rsy''---S(++i i D $ 1" 5#% !%9"&+###rc |dr:d|dkr d|dzS|j|d}|r|dz|dzS|dS)Nrz$http://www.w3.org/XML/1998/namespacezxml:r:)r[)r+r,prefixs r_qnamezXMLGenerator._qname~sfE 7 . 6a@@Q''*473F .|d1g--AwrcP|jr|dd|_dSdS)NrFr_rW)r+ endElements r_finish_pending_start_elementz*XMLGenerator._finish_pending_start_elements7  & 0 KK   */D ' ' ' 0 0rc@|d|jzdS)Nz$ )rWr]r+s r startDocumentzXMLGenerator.startDocuments/ ;' ( ( ( ( (rc.|dSr)rYrjs r endDocumentzXMLGenerator.endDocuments rc|j|j||j|<|j||fdSr)rZappendr[copyr\r+rcuris rstartPrefixMappingzXMLGenerator.startPrefixMappingsV   !6!;!;!=!=>>>%+c"  '' 66666rc:|jd|_|jd=dS)NrT)rZr[r+rcs rendPrefixMappingzXMLGenerator.endPrefixMappings# $ 1" 5  b ! ! !rc ,||d|z|D]-\}}|d|dt|.|jr d|_dS|ddS)Nr =Tr)rhrWrr%r^r_)r+r,attrsr s r startElementzXMLGenerator.startElements **,,, C$J"[[]] = =MT5 KKKDDD)E*:*:*:; < < < <  % *.D ' ' ' KK     rc|jr|dd|_dS|d|zdSNz/>Fzrfr+r,s rrgzXMLGenerator.endElementsI  & ( KK   */D ' ' ' KK$ ' ' ' ' 'rc ||d||z|jD]<\}}|r|d|d|d$|d|z=g|_|D]@\}}|d||dt |A|jr d|_dS|d dS) Nrz xmlns:z="r#z xmlns="%s"rxryTr)rhrWrdr\rr%r^r_)r+r,qnamerzrcrrr s rstartElementNSzXMLGenerator.startElementNSs" **,,, C$++d+++,,,3 1 1KFC 1 <==== MC/0000#% "[[]] J JMT5 KKKDKK$5$5$5$5y7G7G7GH I I I I  % *.D ' ' ' KK     rc|jr|dd|_dS|d||zdSr})r_rWrdr+r,rs r endElementNSzXMLGenerator.endElementNSsV  & 5 KK   */D ' ' ' KK$++d"3"33 4 4 4 4 4rc|rb|t|tst||j}|t |dSdSr)rhr?strr]rWrr+contents r characterszXMLGenerator.characterssg  )  . . 0 0 0gs++ 7gt~66 KKw ( ( ( ( (  ) )rc|rU|t|tst||j}||dSdSr)rhr?rr]rWrs rignorableWhitespacez XMLGenerator.ignorableWhitespacesa  !  . . 0 0 0gs++ 7gt~66 KK  ! !rcf||d|d|ddS)Nz)rhrWr+targetrs rprocessingInstructionz"XMLGenerator.processingInstructions; **,,, 666444011111r)NrRF)F)r/r0r1rVrdrhrkrmrsrvr{rgrrrrrr5rrrQrQps , , , ,"0000(((777 """((($555)))!!!22222rrQceZdZ ddZdZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdS) XMLFilterBaseNcRtj|||_dSr)r XMLReaderrV_parentr+parents rrVzXMLFilterBase.__init__s$$$T*** rc:|j|dSr) _err_handlererrorr+ exceptions rrzXMLFilterBase.errors  *****rc:|j|dSr)r fatalErrorrs rrzXMLFilterBase.fatalErrors $$Y/////rc:|j|dSr)rwarningrs rrzXMLFilterBase.warnings !!),,,,,rc:|j|dSr) _cont_handlersetDocumentLocator)r+locators rrz XMLFilterBase.setDocumentLocators --g66666rc8|jdSr)rrkrjs rrkzXMLFilterBase.startDocuments ((*****rc8|jdSr)rrmrjs rrmzXMLFilterBase.endDocuments &&(((((rc<|j||dSr)rrsrqs rrsz XMLFilterBase.startPrefixMappings! --fc:::::rc:|j|dSr)rrvrus rrvzXMLFilterBase.endPrefixMappings ++F33333rc<|j||dSr)rr{)r+r,rzs rr{zXMLFilterBase.startElement ! ''e44444rc:|j|dSr)rrgr~s rrgzXMLFilterBase.endElements %%d+++++rc>|j|||dSr)rr)r+r,rrzs rrzXMLFilterBase.startElementNSs# ))$u=====rc<|j||dSr)rrrs rrzXMLFilterBase.endElementNSrrc:|j|dSr)rrrs rrzXMLFilterBase.characterss %%g.....rc:|j|dSr)rr)r+charss rrz!XMLFilterBase.ignorableWhitespaces ..u55555rc<|j||dSr)rrrs rrz#XMLFilterBase.processingInstructions! 00>>>>>rc:|j|dSr)r skippedEntityr~s rrzXMLFilterBase.skippedEntity s ((.....rc>|j|||dSr) _dtd_handler notationDecl)r+r,publicIdsystemIds rrzXMLFilterBase.notationDecl%s# &&tXx@@@@@rc@|j||||dSr)runparsedEntityDecl)r+r,rrndatas rrz XMLFilterBase.unparsedEntityDecl(s% ,,T8XuMMMMMrc8|j||Sr) _ent_handler resolveEntity)r+rrs rrzXMLFilterBase.resolveEntity-s ..xBBBrc |j||j||j||j||j|dSr)rsetContentHandlersetErrorHandlersetEntityResolver setDTDHandlerparse)r+sources rrzXMLFilterBase.parse2sv &&t,,, $$T*** &&t,,, ""4((( 6"""""rc:|j|dSr)r setLocale)r+locales rrzXMLFilterBase.setLocale9s v&&&&&rc6|j|Sr)r getFeaturer~s rrzXMLFilterBase.getFeature<s|&&t,,,rc<|j||dSr)r setFeature)r+r,states rrzXMLFilterBase.setFeature?s  e,,,,,rc6|j|Sr)r getPropertyr~s rrzXMLFilterBase.getPropertyBs|''---rc<|j||dSr)r setProperty)r+r,r s rrzXMLFilterBase.setPropertyEs    u-----rc|jSrrrjs r getParentzXMLFilterBase.getParentJs |rc||_dSrrrs r setParentzXMLFilterBase.setParentMs  rr)r/r0r1rVrrrrrkrmrsrvr{rgrrrrrrrrrrrrrrrrrr5rrrrs +++000--- 777+++)));;;444555,,,>>>555///666???/// AAANNN CCC ###'''------...... rrc t|tjrtj|}t|trt j|}nt|dr|}t j}t|dtr| |n| |t|dr4t|j tr| |j | C|.|}tjtj|}tj||}tj|r&| |t+|d}nd| t,j||t,j|}| ||S)Nreadrr,rb)r?osPathLikefspathrr InputSourcehasattrrsetCharacterStream setByteStreamr, setSystemIdgetCharacterStream getByteStream getSystemIdpathdirnamenormpathjoinisfileopenurllibrurljoinrequesturlopen)rbasefsysidbasehead sysidfilenames rprepare_input_sourcerRsF&"+&&#6""&# '&v..  ' &(( affQii % % $  % %a ( ( ( (   # # # 1f   '*QVS"9"9 '   qv & & &   ""*v/C/C/E/E/M""$$7??27#3#3D#9#9:: Xu55 7>>- ( ( =   } - - -]D))AA   v|33D%@@ A A A&&v'9'9';';<rsZ ('''''''''''      & & & & .'0'0'0Rp2p2p2p2p27)p2p2p2fkkkkkI'kkk^rPKN\001sax/__pycache__/_exceptions.cpython-311.opt-1.pycnu[ !A?hdZddlZejdddkrddlmZ[GddeZGdd eZGd d eZGd d eZGddeZ dS)z!Different kinds of SAX ExceptionsNjava) Exceptionc2eZdZdZddZdZdZdZdZdS) SAXExceptionaEncapsulate an XML error or warning. This class can contain basic error or warning information from either the XML parser or the application: you can subclass it to provide additional functionality, or to add localization. Note that although you will receive a SAXException as the argument to the handlers in the ErrorHandler interface, you are not actually required to raise the exception; instead, you can simply read the information in it.NcL||_||_tj||dS)zUCreates an exception. The message is required, but the exception is optional.N)_msg _exceptionr__init__)selfmsg exceptions @/opt/alt/python-internal/lib64/python3.11/xml/sax/_exceptions.pyr zSAXException.__init__s+ #4%%%%%c|jS)z$Return a message for this exception.r r s r getMessagezSAXException.getMessage yrc|jS)z9Return the embedded exception, or None if there was none.)r rs r getExceptionzSAXException.getExceptions rc|jS)0Create a string representation of the exception.rrs r__str__zSAXException.__str__"rrc td)zvAvoids weird error messages if someone does exception[ix] by mistake, since Exception has __getitem__ defined. __getitem__)AttributeError)r ixs rrzSAXException.__getitem__&s]+++r)N) __name__ __module__ __qualname____doc__r rrrrrrrr sn  &&&&,,,,,rrc6eZdZdZdZdZdZdZdZdZ dS) SAXParseExceptiona#Encapsulate an XML parse error or warning. This exception will include information for locating the error in the original XML document. Note that although the application will receive a SAXParseException as the argument to the handlers in the ErrorHandler interface, the application is not actually required to raise the exception; instead, it can simply read the information in it and take a different action. Since this exception is a subclass of SAXException, it inherits the ability to wrap another exception.ct|||||_|j|_|j|_|j|_dS)zECreates the exception. The exception parameter is allowed to be None.N) rr _locator getSystemId _systemIdgetColumnNumber_colnum getLineNumber_linenum)r r rlocators rr zSAXParseException.__init__;sfdC333 2244}4466  3355 rc|jS)zNThe column number of the end of the text where the exception occurred.)r+rs rr*z!SAXParseException.getColumnNumberHs |rc|jS)zDThe line number of the end of the text where the exception occurred.)r-rs rr,zSAXParseException.getLineNumberMs }rc4|jS)zEGet the public identifier of the entity where the exception occurred.)r' getPublicIdrs rr2zSAXParseException.getPublicIdQs}((***rc|jS)zEGet the system identifier of the entity where the exception occurred.)r)rs rr(zSAXParseException.getSystemIdUs ~rc|}|d}|}|d}|}|d}|d|d|d|jS)rNz ?:z: )r(r,r*r )r sysidlinenumcolnums rrzSAXParseException.__str__Ysr  "" =E$$&& ?G%%'' >F!&CCrN) rr r!r"r r*r,r2r(rr#rrr%r%.s} . . 6 6 6 +++ D D D D Drr%ceZdZdZdS)SAXNotRecognizedExceptionzException class for an unrecognized identifier. An XMLReader will raise this exception when it is confronted with an unrecognized feature or property. SAX applications and extensions may use this class for similar purposes.Nrr r!r"r#rrr;r;is,,,,rr;ceZdZdZdS)SAXNotSupportedExceptionaException class for an unsupported operation. An XMLReader will raise this exception when a service it cannot perform is requested (specifically setting a state or value). SAX applications and extensions may use this class for similar purposes.Nr<r#rrr>r>ssrr>ceZdZdZdS)SAXReaderNotAvailableaException class for a missing driver. An XMLReader module (driver) should raise this exception when it is first imported, e.g. when a support module cannot be imported. It also may be raised during parsing, e.g. if executing an external program is not permitted.Nr<r#rrr@r@}s!!!!rr@) r"sysplatform java.langrrr%r;r>r@r#rrrDs&'' <v###### , , , , ,9 , , ,J6D6D6D6D6D 6D6D6Dv,,,,, ,,,|!!!!!4!!!!!rPKN\_1sax/__pycache__/_exceptions.cpython-311.opt-2.pycnu[ !A?h ddlZejdddkrddlmZ[GddeZGddeZGd d eZGd d eZGd deZdS)Njava) Exceptionc0eZdZ ddZdZdZdZdZdS) SAXExceptionNcN ||_||_tj||dSN)_msg _exceptionr__init__)selfmsg exceptions @/opt/alt/python-internal/lib64/python3.11/xml/sax/_exceptions.pyr zSAXException.__init__s.  #4%%%%%c |jSr r r s r getMessagezSAXException.getMessages .yrc |jSr )r rs r getExceptionzSAXException.getExceptions Crc |jSr rrs r__str__zSAXException.__str__"s :yrc" td)N __getitem__)AttributeError)r ixs rrzSAXException.__getitem__&s =]+++rr )__name__ __module__ __qualname__r rrrrrrrr si &&&&,,,,,rrc4eZdZ dZdZdZdZdZdZdS)SAXParseExceptionc t|||||_|j|_|j|_|j|_dSr ) rr _locator getSystemId _systemIdgetColumnNumber_colnum getLineNumber_linenum)r rrlocators rr zSAXParseException.__init__;siOdC333 2244}4466  3355 rc |jSr )r)rs rr(z!SAXParseException.getColumnNumberHs |rc |jSr )r+rs rr*zSAXParseException.getLineNumberMs N}rc6 |jSr )r% getPublicIdrs rr0zSAXParseException.getPublicIdQsO}((***rc |jSr )r'rs rr&zSAXParseException.getSystemIdUs O~rc |}|d}|}|d}|}|d}|d|d|d|jS)Nz ?:z: )r&r*r(r )r sysidlinenumcolnums rrzSAXParseException.__str__Ysu:  "" =E$$&& ?G%%'' >F!&CCrN) rrr r r(r*r0r&rr!rrr#r#.sx . 6 6 6 +++ D D D D Drr#ceZdZdS)SAXNotRecognizedExceptionNrrr r!rrr9r9is,,rr9ceZdZdS)SAXNotSupportedExceptionNr:r!rrr<r<ssrr<ceZdZdS)SAXReaderNotAvailableNr:r!rrr>r>}s!!rr>) sysplatform java.langrrr#r9r<r>r!rrrBs#' <v###### , , , , ,9 , , ,J6D6D6D6D6D 6D6D6Dv,,,,, ,,,|!!!!!4!!!!!rPKN\WW1sax/__pycache__/expatreader.cpython-311.opt-2.pycnu[ !A?hS? dZddlTddlmZmZddlmZddlmZmZddlmZddlm Z m Z ddl Z e j dd d kr e d d[ dd lmZeed s e ddn#e$r e ddwxYwddlmZmZmZejZejZ ddlZddlZejZ[[n#e$rdZYnwxYwGddZGddejZGddejejZ dZ!e"dkrddl#Z$e!Z%e%&e$j'j(e%)e$j'*e%+ddSdS)z0.20)*)feature_validationfeature_namespaces)feature_namespace_prefixes)feature_external_gesfeature_external_pes)feature_string_interning)property_xml_stringproperty_interning_dictNjavazexpat not available in Java)expat ParserCreatezexpat not supported) xmlreadersaxutilshandlerc|SN)os @/opt/alt/python-internal/lib64/python3.11/xml/sax/expatreader.py_mkproxyr'sceZdZdS) _ClosedParserN)__name__ __module__ __qualname__rrrrr.sDrrc.eZdZ dZdZdZdZdZdS) ExpatLocatorc.t||_dSr)r_refselfparsers r__init__zExpatLocator.__init__9sV$$ rc:|j}|jdS|jjSr)r"_parserErrorColumnNumberr#s rgetColumnNumberzExpatLocator.getColumnNumber<s! > !4~//rc:|j}|jdS|jjSN)r"r(ErrorLineNumberr#s r getLineNumberzExpatLocator.getLineNumberBs! > !1~--rcJ|j}|dS|jSr)r"_source getPublicIdr#s rr2zExpatLocator.getPublicIdH' >4~))+++rcJ|j}|dS|jSr)r"r1 getSystemIdr#s rr5zExpatLocator.getSystemIdNr3rN)rrrr&r*r/r2r5rrrr r 3sd %%%000 ... ,,, ,,,,,rr ceZdZ d%dZdZdZdZdZdZd Z d Z d&d Z d Z dZ dZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZd Zd!Z d"Z!d#Z"d$S)' ExpatParserrctj||tj|_d|_||_d|_d|_g|_ d|_ d|_ dS)NFr) rIncrementalParserr& InputSourcer1r( _namespaces_lex_handler_prop_parsing _entity_stack _external_ges _interning)r$namespaceHandlingbufsizes rr&zExpatParser.__init__Zsd#,,T7;;; ,..  ,!% rc* tj|}||_ ||jt |tj ||dS#| xYwr) rprepare_input_sourcer1reset _cont_handlersetDocumentLocatorr rr:parse _close_sourcer$sources rrIzExpatParser.parsegs=.v66   JJLLL   1 1,t2D2D E E E  ' - -dF ; ; ; ; ;     s AA;;Bc|.|j|dSdSr)r5r(SetBaserKs r prepareParserzExpatParser.prepareParserwsD      + L !3!3!5!5 6 6 6 6 6 , +rctj|||jr|dSdSr)rr:setContentHandlerr>_reset_cont_handler)r$rs rrQzExpatParser.setContentHandler}sG#55dGDDD = '  $ $ & & & & & ' 'rc|tkr|jS|tkr |jduS|tt t fvrdS|tkr|jStd|z)NrFeature '%s' not recognized) rr<r rArrrrr@SAXNotRecognizedExceptionr$names r getFeaturezExpatParser.getFeaturesy % % %# # - - -?$. . (*>02221 ) ) )% %'(E(LMMMrc|jrtd|tkr ||_dS|tkr ||_dS|t kr|r|j i|_dSdSd|_dS|tkr|rtddS|tkr|rtddS|tkr|rtddStd|z)Nz!Cannot set features while parsingz!expat does not support validationz/expat does not read external parameter entitiesz(expat does not report namespace prefixesrT) r>SAXNotSupportedExceptionrr<rr@r rArrrrU)r$rWstates r setFeaturezExpatParser.setFeaturesQ = P*+NOO O % % %$D    ) ) )!&D    - - - '?*&(DOOO+*#' ' ' ' 9.7999 9 9) ) ) G.EGGG G G/ / / @.>@@@ @ @,-466 6rc4|tjkr|jS|tkr|jS|t krS|jr=t|jdr|jStdtdtd|z)NGetInputContextz=This version of expat does not support getting the XML stringz.XML string cannot be returned when not parsingProperty '%s' not recognized) rproperty_lexical_handlerr=r rAr r(hasattrr^rUrZrVs r getPropertyzExpatParser.getPropertys 73 3 3) ) , , ,? " ( ( (| F4<):;;+<779993*+++/DFFF'(F(MNNNrc|tjkr&||_|jr|dSdS|t kr ||_dS|tkrtd|ztd|z)NzProperty '%s' cannot be setr_) rr`r=r>_reset_lex_handler_propr rAr rZrU)r$rWvalues r setPropertyzExpatParser.setPropertys 73 3 3%*D "} /,,..... / / , , ,#DOOO ( ( (*+H+/,011 1,,J,0-122 2rFcr|js4|d|_|j |j||dS#t j$rM}tt j |j ||}|j |Yd}~dSd}~wwxYw)NT) r>rFrG startDocumentr(ParsererrorSAXParseException ErrorStringcode _err_handler fatalError)r$dataisFinaleexcs rfeedzExpatParser.feeds} / JJLLL DM   , , . . . . L  tW - - - - -{ . . .#E$5af$=$=q$GGC   ( ( - - - - - - - - - .sAB6)AB11B6c|jdS|j} |jd|jddn^#tj$rL}t t j|j||}|j |Yd}~nd}~wwxYw|j|dS#|j|wxYw)NFr) r(GetReparseDeferralEnabledSetReparseDeferralEnabledrirrjrkrlrmrnro)r$ was_enabledrrrss rflushzExpatParser.flushs <  Fl<<>>  @ L 2 25 9 9 9 L  sE * * * *{ . . .#E$5af$=$=q$GGC   ( ( - - - - - - - - . L 2 2; ? ? ? ? ?DL 2 2; ? ? ? ?s05ACB5)AB0+C0B55CC0c"|j} |}|||}||dSdS#|}||wwxYwr)r1getCharacterStreamclose getByteStream)r$rLfiles rrJzExpatParser._close_sources ,,..D ''))D  ''))D  s *A!!-BcF|js!|jt|jtrdS |dd|jd|_d|_d|_|j7t}|jj|_|jj |_ ||_| dS#d|_|j7t}|jj|_|jj |_ ||_| wxYw)NrT)rqF) r?r( isinstancerrtrG endDocumentr>r)r.rJr#s rr|zExpatParser.closes   $,"6 t|] 3 3#7 F ! IIc4I ( ( (   * * , , ,!DMDL!DM|'&+/<+I()-)E&%    "DM|'&+/<+I()-)E&%    s >CAD c^|jj|j_|jj|j_dSr)rGprocessingInstructionr(ProcessingInstructionHandler charactersCharacterDataHandlerr$s rrRzExpatParser._reset_cont_handler s+$($6$L 1,0,>,I )))rc|j}|j}|%d|_d|_d|_d|_d|_dS|j|_|j|_|j |_|j |_|j |_dSr) r=r(CommentHandlerStartCdataSectionHandlerEndCdataSectionHandlerStartDoctypeDeclHandlerEndDoctypeDeclHandlercomment startCDATAendCDATAstart_doctype_declendDTD)r$lexr%s rrdz#ExpatParser._reset_lex_handler_props}$ ;$(F !.2F +,0F )-1F *+/F ( ( ($'KF !.1nF +,/LF )-1-DF *+.:F ( ( (rcT|jrgtj|jd|j|_d|j_|j|j_ |j |j_ nYtj|j|j|_|j |j_ |j |j_ ||j|j_|j|j_|j|j_|j|j_d|_|jr||j|j_ |j|j_n#t<$rYnwxYw|jtj d|_!g|_"dS)N )internr-F)#r<rrr1 getEncodingrAr(namespace_prefixesstart_element_nsStartElementHandlerend_element_nsEndElementHandler start_element end_elementrRunparsed_entity_declUnparsedEntityDeclHandler notation_declNotationDeclHandlerstart_namespace_declStartNamespaceDeclHandlerend_namespace_declEndNamespaceDeclHandler_decl_handler_propr=rdexternal_entity_refExternalEntityRefHandlerskipped_entity_handlerSkippedEntityHandlerAttributeErrorSetParamEntityParsing*XML_PARAM_ENTITY_PARSING_UNLESS_STANDALONEr>r?rs rrFzExpatParser.reset"s   > -dl.F.F.H.H#59_FFFDL./DL +/3/DDL ,-1-@DL * * -dl.F.F.H.H7;HHHDL/3/ADL ,-1-=DL *   """151J .+/+= (151J ./3/F ,"&  ! +  ( ( * * *150H - 040KDL - -    D  **  < > > > sE&& E32E3c,|jdS|jjSr)r(r)rs rr*zExpatParser.getColumnNumberIs < 4|--rc,|jdS|jjSr,)r(r.rs rr/zExpatParser.getLineNumberNs < 1|++rc4|jSr)r1r2rs rr2zExpatParser.getPublicIdS|'')))rc4|jSr)r1r5rs rr5zExpatParser.getSystemIdVrrcV|j|t|dSr)rG startElementAttributesImpl)r$rWattrss rrzExpatParser.start_elementZs) ''nU.C.CDDDDDrc:|j|dSr)rG endElementrVs rrzExpatParser.end_element] %%d+++++rcJ|}t|dkrd|f}n3t|dkr|d|df}nt|}i}i}|D]\}}|}t|} | dkr|} d|f} nA| dkr$|dd|d} |d|df} n|d} t|} ||| <| || <|j|dt ||dS)Nr-r:)splitlentupleitemsrGstartElementNSAttributesNSImpl) r$rWrpairnewattrsqnamesanamerepartslengthqnameapairs rrzExpatParser.start_element_ns`sIzz|| t99>>$
>$
>>>>rc:|j|dSr)rGr)r$rps rcharacter_datazExpatParser.character_datarrc<|j||dSr)rGstartPrefixMapping)r$prefixuris rrz ExpatParser.start_namespace_decls! --fc:::::rc:|j|dSr)rGendPrefixMapping)r$rs rrzExpatParser.end_namespace_decls ++F33333rc>|j|||dSr)r=startDTD)r$rWsysidpubidhas_internal_subsets rrzExpatParser.start_doctype_decls# ''eU;;;;;rc@|j||||dSr) _dtd_handlerunparsedEntityDecl)r$rWbaserr notation_names rrz ExpatParser.unparsed_entity_decls% ,,T5%OOOOOrc>|j|||dSr)r notationDecl)r$rWrrrs rrzExpatParser.notation_decls# &&tUE:::::rc|jsdS|j||}tj||jpd}|j|j |jf|j ||_ ||_ tj ||n#YdSxYw|jd\|_ |_|jd=dS)Nr-r)r@ _ent_handler resolveEntityrrEr1r5r?appendr(ExternalEntityParserCreaterr:rI)r$contextrrrrLs rrzExpatParser.external_entity_refs! 1"00>>.v/3|/G/G/I/I02/133 !!4<">???|>>wGG     ' - -dF ; ; ; ; 11'+'9"'=$t|  r "qs CCcH|rd|z}|j|dS)N%)rG skippedEntity)r$rWis_pes rrz"ExpatParser.skipped_entity_handlers0  t8D ((.....rN)rr8)F)#rrrr&rIrOrQrXr\rbrfrtryrJr|rRrdrFr*r/r2r5rrrrrrrrrrrrrrrrr7r7Ws.     777 ''' N N N666<OOO$ 2 2 2 ...." @ @ @   !!!*JJJ 666 # # # N... ,,, ******EEE,,, N N ND 4 4 4???,,,;;;444<<<PPP;;;,/////rr7ct|i|Sr)r7)argskwargss r create_parserrs  ' ' ''r__main__z:http://www.ibiblio.org/xml/examples/shakespeare/hamlet.xml),versionxml.sax._exceptionsxml.sax.handlerrrrrrr r r sysplatformSAXReaderNotAvailable xml.parsersrra ImportErrorxml.saxrrrrr_weakrefweakrefproxyrrLocatorr r:r7rrxml.sax.saxutilsxmlprQsax XMLGeneratorsetErrorHandler ErrorHandlerrIrrrr s !!!!BBBBBBBB666666FFFFFFFF444444HHHHHHHH <v   =t D DDA!!!!!! 75. ) )A##$94@@@A===   5t < <<= 1000000000)- OOO NNN}H         ,,,,,9$,,,Hg/g/g/g/g/)-y/@g/g/g/V (((  z A(5577888cg**,,---GG HIIIII sA00BB00B;:B;PKN\S-sax/__pycache__/handler.cpython-311.opt-2.pycnu[ !A?h= dZGddZGddZGddZGddZd Zd Zd Zd Zd Z dZ eeeee e gZ dZ dZ dZdZdZdZe ee eeegZGddZdS)z2.0betac"eZdZ dZdZdZdS) ErrorHandlerc |Nself exceptions rls  2\\\\\\\\B 7 7 7 7 7 7 7 7        (> NJ > O Q#*("$$ & K S =A DP+#.%#) +*9*9*9*9*9*9*9*9*9*9r PKN\jи]T]T.sax/__pycache__/saxutils.cpython-311.opt-1.pycnu[ !A?h/dZddlZddlZddlZddlZddlZddlmZddlm Z dZ ifdZ ifdZ ifd Z d ZGd d ejZGd de jZddZdS)znA library of useful helper classes to the SAX classes, for the convenience of application and driver writers. N)handler) xmlreadercf|D]\}}|||}|S)z2Replace substrings of a string using a dictionary.)itemsreplace)sdkeyvalues =/opt/alt/python-internal/lib64/python3.11/xml/sax/saxutils.py__dict_replacer s7ggii"" U IIc5 ! ! Hc|dd}|dd}|dd}|rt||}|S)zEscape &, <, and > in a string of data. You can escape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. &&>><<rrdataentitiess r escapersY <<W % %D <<V $ $D <<V $ $D.dH-- Krc|dd}|dd}|rt||}|ddS)a Unescape &, <, and > in a string of data. You can unescape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. rrrrrrrrs r unescaper"sU << $ $D << $ $D.dH-- << % %%rci|dddd}t||}d|vr$d|vrd|ddz}n d |z}nd|z}|S) aEscape and quote an attribute value. Escape &, <, and > in a string of data, then quote it for use as an attribute value. The " character will be escaped as well, if necessary. You can escape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. z z z )   "'z"%s"z"z'%s')rrrs r quoteattrr$0srG(F'vFFFH $ ! !D d{{ $;;DLLh777DDD=DD} Krc ddl}|jSttjrStt jt jfrSttjr"Gfdd}|}d|_ nQtj }d|_ j |_ j |_ j|_n#t$rYnwxYwtj||ddd S) Nrc(eZdZjZfdZdS) _gettextwriter.._wrapperc$t|SN)getattr)selfnameouts r __getattr__z,_gettextwriter.._wrapper.__getattr__ZssD)))rN)__name__ __module__ __qualname__ __class__r.)r-sr _wrapperr'Xs5 I * * * * * * *rr3cdSr)r5rr z _gettextwriter..]strcdS)NTr5r5rr r6z _gettextwriter..bs$rxmlcharrefreplacerT)encodingerrorsnewline write_through)sysstdout isinstanceio TextIOBasecodecs StreamWriterStreamReaderWriter RawIOBasecloseBufferedIOBasewritablewriteseekabletellAttributeError TextIOWrapper)r-r9r=r3buffers` r _gettextwriterrOGs8 { z#r}%% #+V-FGHH #r|$$ * * * * * * * * * *#| "$$&,y  "lFO(FKK    D  FX#6$(*. 0 0 00s7C CCcfeZdZddZdZddZdZdZd Zd Z d Z d Z d Z dZ dZdZdZdS) XMLGeneratorN iso-8859-1Fctj|t||}|j|_|j|_ig|_|jd|_ g|_ ||_ ||_ d|_ dS)NF)rContentHandler__init__rOrI_writeflush_flush _ns_contexts_current_context_undeclared_ns_maps _encoding_short_empty_elements_pending_start_element)r+r-r9short_empty_elementss r rVzXMLGenerator.__init__rsy''---S(++i i D $ 1" 5#% !%9"&+###rc|dr:d|dkr d|dzS|j|d}|r|dz|dzS|dS)z7Builds a qualified name from a (ns_url, localname) pairrz$http://www.w3.org/XML/1998/namespacezxml:r:)r[)r+r,prefixs r _qnamezXMLGenerator._qname~sc 7 . 6a@@Q''*473F .|d1g--AwrcP|jr|dd|_dSdS)NrFr_rW)r+ endElements r _finish_pending_start_elementz*XMLGenerator._finish_pending_start_elements7  & 0 KK   */D ' ' ' 0 0rc@|d|jzdS)Nz$ )rWr]r+s r startDocumentzXMLGenerator.startDocuments/ ;' ( ( ( ( (rc.|dSr))rYrjs r endDocumentzXMLGenerator.endDocuments rc|j|j||j|<|j||fdSr))rZappendr[copyr\r+rcuris r startPrefixMappingzXMLGenerator.startPrefixMappingsV   !6!;!;!=!=>>>%+c"  '' 66666rc:|jd|_|jd=dS)NrT)rZr[r+rcs r endPrefixMappingzXMLGenerator.endPrefixMappings# $ 1" 5  b ! ! !rc ,||d|z|D]-\}}|d|dt|.|jr d|_dS|ddS)Nr =Tr)rhrWrr$r^r_)r+r,attrsr s r startElementzXMLGenerator.startElements **,,, C$J"[[]] = =MT5 KKKDDD)E*:*:*:; < < < <  % *.D ' ' ' KK     rc|jr|dd|_dS|d|zdSNz/>Fzrfr+r,s r rgzXMLGenerator.endElementsI  & ( KK   */D ' ' ' KK$ ' ' ' ' 'rc ||d||z|jD]<\}}|r|d|d|d$|d|z=g|_|D]@\}}|d||dt |A|jr d|_dS|d dS) Nrz xmlns:z="r"z xmlns="%s"rxryTr)rhrWrdr\rr$r^r_)r+r,qnamerzrcrrr s r startElementNSzXMLGenerator.startElementNSs" **,,, C$++d+++,,,3 1 1KFC 1 <==== MC/0000#% "[[]] J JMT5 KKKDKK$5$5$5$5y7G7G7GH I I I I  % *.D ' ' ' KK     rc|jr|dd|_dS|d||zdSr})r_rWrdr+r,rs r endElementNSzXMLGenerator.endElementNSsV  & 5 KK   */D ' ' ' KK$++d"3"33 4 4 4 4 4rc|rb|t|tst||j}|t |dSdSr))rhr?strr]rWrr+contents r characterszXMLGenerator.characterssg  )  . . 0 0 0gs++ 7gt~66 KKw ( ( ( ( (  ) )rc|rU|t|tst||j}||dSdSr))rhr?rr]rWrs r ignorableWhitespacez XMLGenerator.ignorableWhitespacesa  !  . . 0 0 0gs++ 7gt~66 KK  ! !rcf||d|d|ddS)Nz)rhrWr+targetrs r processingInstructionz"XMLGenerator.processingInstructions; **,,, 666444011111r)NrRF)F)r/r0r1rVrdrhrkrmrsrvr{rgrrrrrr5rr rQrQps , , , ,"0000(((777 """((($555)))!!!22222rrQceZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdS) XMLFilterBaseaYThis class is designed to sit between an XMLReader and the client application's event handlers. By default, it does nothing but pass requests up to the reader and events on to the handlers unmodified, but subclasses can override specific methods to modify the event stream or the configuration requests as they pass through.NcRtj|||_dSr))r XMLReaderrV_parentr+parents r rVzXMLFilterBase.__init__s$$$T*** rc:|j|dSr)) _err_handlererrorr+ exceptions r rzXMLFilterBase.errors  *****rc:|j|dSr))r fatalErrorrs r rzXMLFilterBase.fatalErrors $$Y/////rc:|j|dSr))rwarningrs r rzXMLFilterBase.warnings !!),,,,,rc:|j|dSr)) _cont_handlersetDocumentLocator)r+locators r rz XMLFilterBase.setDocumentLocators --g66666rc8|jdSr))rrkrjs r rkzXMLFilterBase.startDocuments ((*****rc8|jdSr))rrmrjs r rmzXMLFilterBase.endDocuments &&(((((rc<|j||dSr))rrsrqs r rsz XMLFilterBase.startPrefixMappings! --fc:::::rc:|j|dSr))rrvrus r rvzXMLFilterBase.endPrefixMappings ++F33333rc<|j||dSr))rr{)r+r,rzs r r{zXMLFilterBase.startElement ! ''e44444rc:|j|dSr))rrgr~s r rgzXMLFilterBase.endElements %%d+++++rc>|j|||dSr))rr)r+r,rrzs r rzXMLFilterBase.startElementNSs# ))$u=====rc<|j||dSr))rrrs r rzXMLFilterBase.endElementNSrrc:|j|dSr))rrrs r rzXMLFilterBase.characterss %%g.....rc:|j|dSr))rr)r+charss r rz!XMLFilterBase.ignorableWhitespaces ..u55555rc<|j||dSr))rrrs r rz#XMLFilterBase.processingInstructions! 00>>>>>rc:|j|dSr))r skippedEntityr~s r rzXMLFilterBase.skippedEntity s ((.....rc>|j|||dSr)) _dtd_handler notationDecl)r+r,publicIdsystemIds r rzXMLFilterBase.notationDecl%s# &&tXx@@@@@rc@|j||||dSr))runparsedEntityDecl)r+r,rrndatas r rz XMLFilterBase.unparsedEntityDecl(s% ,,T8XuMMMMMrc8|j||Sr)) _ent_handler resolveEntity)r+rrs r rzXMLFilterBase.resolveEntity-s ..xBBBrc |j||j||j||j||j|dSr))rsetContentHandlersetErrorHandlersetEntityResolver setDTDHandlerparse)r+sources r rzXMLFilterBase.parse2sv &&t,,, $$T*** &&t,,, ""4((( 6"""""rc:|j|dSr))r setLocale)r+locales r rzXMLFilterBase.setLocale9s v&&&&&rc6|j|Sr))r getFeaturer~s r rzXMLFilterBase.getFeature<s|&&t,,,rc<|j||dSr))r setFeature)r+r,states r rzXMLFilterBase.setFeature?s  e,,,,,rc6|j|Sr))r getPropertyr~s r rzXMLFilterBase.getPropertyBs|''---rc<|j||dSr))r setProperty)r+r,r s r rzXMLFilterBase.setPropertyEs    u-----rc|jSr)rrjs r getParentzXMLFilterBase.getParentJs |rc||_dSr)rrs r setParentzXMLFilterBase.setParentMs  rr)) r/r0r1__doc__rVrrrrrkrmrsrvr{rgrrrrrrrrrrrrrrrrrr5rr rrs +++000--- 777+++)));;;444555,,,>>>555///666???/// AAANNN CCC ###'''------...... rrct|tjrtj|}t|trt j|}nt|dr|}t j}t|dtr| |n| |t|dr4t|j tr| |j | C|.|}tjtj|}tj||}tj|r&| |t+|d}nd| t,j||t,j|}| ||S)zThis function takes an InputSource and an optional base URL and returns a fully resolved InputSource object ready for reading.readrr,Nrb)r?osPathLikefspathrr InputSourcehasattrrsetCharacterStream setByteStreamr, setSystemIdgetCharacterStream getByteStream getSystemIdpathdirnamenormpathjoinisfileopenurllibrurljoinrequesturlopen)rbasefsysidbasehead sysidfilenames r prepare_input_sourcerRs&"+&&#6""&# '&v..  ' &(( affQii % % $  % %a ( ( ( (   # # # 1f   '*QVS"9"9 '   qv & & &   ""*v/C/C/E/E/M""$$7??27#3#3D#9#9:: Xu55 7>>- ( ( =   } - - -]D))AA   v|33D%@@ A A A&&v'9'9';';<rs_ ('''''''''''      & & & & .'0'0'0Rp2p2p2p2p27)p2p2p2fkkkkkI'kkk^rPKN\jи]T]T(sax/__pycache__/saxutils.cpython-311.pycnu[ !A?h/dZddlZddlZddlZddlZddlZddlmZddlm Z dZ ifdZ ifdZ ifd Z d ZGd d ejZGd de jZddZdS)znA library of useful helper classes to the SAX classes, for the convenience of application and driver writers. N)handler) xmlreadercf|D]\}}|||}|S)z2Replace substrings of a string using a dictionary.)itemsreplace)sdkeyvalues =/opt/alt/python-internal/lib64/python3.11/xml/sax/saxutils.py__dict_replacer s7ggii"" U IIc5 ! ! Hc|dd}|dd}|dd}|rt||}|S)zEscape &, <, and > in a string of data. You can escape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. &&>><<rrdataentitiess r escapersY <<W % %D <<V $ $D <<V $ $D.dH-- Krc|dd}|dd}|rt||}|ddS)a Unescape &, <, and > in a string of data. You can unescape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. rrrrrrrrs r unescaper"sU << $ $D << $ $D.dH-- << % %%rci|dddd}t||}d|vr$d|vrd|ddz}n d |z}nd|z}|S) aEscape and quote an attribute value. Escape &, <, and > in a string of data, then quote it for use as an attribute value. The " character will be escaped as well, if necessary. You can escape other strings of data by passing a dictionary as the optional entities parameter. The keys and values must all be strings; each key will be replaced with its corresponding value. z z z )   "'z"%s"z"z'%s')rrrs r quoteattrr$0srG(F'vFFFH $ ! !D d{{ $;;DLLh777DDD=DD} Krc ddl}|jSttjrStt jt jfrSttjr"Gfdd}|}d|_ nQtj }d|_ j |_ j |_ j|_n#t$rYnwxYwtj||ddd S) Nrc(eZdZjZfdZdS) _gettextwriter.._wrapperc$t|SN)getattr)selfnameouts r __getattr__z,_gettextwriter.._wrapper.__getattr__ZssD)))rN)__name__ __module__ __qualname__ __class__r.)r-sr _wrapperr'Xs5 I * * * * * * *rr3cdSr)r5rr z _gettextwriter..]strcdS)NTr5r5rr r6z _gettextwriter..bs$rxmlcharrefreplacerT)encodingerrorsnewline write_through)sysstdout isinstanceio TextIOBasecodecs StreamWriterStreamReaderWriter RawIOBasecloseBufferedIOBasewritablewriteseekabletellAttributeError TextIOWrapper)r-r9r=r3buffers` r _gettextwriterrOGs8 { z#r}%% #+V-FGHH #r|$$ * * * * * * * * * *#| "$$&,y  "lFO(FKK    D  FX#6$(*. 0 0 00s7C CCcfeZdZddZdZddZdZdZd Zd Z d Z d Z d Z dZ dZdZdZdS) XMLGeneratorN iso-8859-1Fctj|t||}|j|_|j|_ig|_|jd|_ g|_ ||_ ||_ d|_ dS)NF)rContentHandler__init__rOrI_writeflush_flush _ns_contexts_current_context_undeclared_ns_maps _encoding_short_empty_elements_pending_start_element)r+r-r9short_empty_elementss r rVzXMLGenerator.__init__rsy''---S(++i i D $ 1" 5#% !%9"&+###rc|dr:d|dkr d|dzS|j|d}|r|dz|dzS|dS)z7Builds a qualified name from a (ns_url, localname) pairrz$http://www.w3.org/XML/1998/namespacezxml:r:)r[)r+r,prefixs r _qnamezXMLGenerator._qname~sc 7 . 6a@@Q''*473F .|d1g--AwrcP|jr|dd|_dSdS)NrFr_rW)r+ endElements r _finish_pending_start_elementz*XMLGenerator._finish_pending_start_elements7  & 0 KK   */D ' ' ' 0 0rc@|d|jzdS)Nz$ )rWr]r+s r startDocumentzXMLGenerator.startDocuments/ ;' ( ( ( ( (rc.|dSr))rYrjs r endDocumentzXMLGenerator.endDocuments rc|j|j||j|<|j||fdSr))rZappendr[copyr\r+rcuris r startPrefixMappingzXMLGenerator.startPrefixMappingsV   !6!;!;!=!=>>>%+c"  '' 66666rc:|jd|_|jd=dS)NrT)rZr[r+rcs r endPrefixMappingzXMLGenerator.endPrefixMappings# $ 1" 5  b ! ! !rc ,||d|z|D]-\}}|d|dt|.|jr d|_dS|ddS)Nr =Tr)rhrWrr$r^r_)r+r,attrsr s r startElementzXMLGenerator.startElements **,,, C$J"[[]] = =MT5 KKKDDD)E*:*:*:; < < < <  % *.D ' ' ' KK     rc|jr|dd|_dS|d|zdSNz/>Fzrfr+r,s r rgzXMLGenerator.endElementsI  & ( KK   */D ' ' ' KK$ ' ' ' ' 'rc ||d||z|jD]<\}}|r|d|d|d$|d|z=g|_|D]@\}}|d||dt |A|jr d|_dS|d dS) Nrz xmlns:z="r"z xmlns="%s"rxryTr)rhrWrdr\rr$r^r_)r+r,qnamerzrcrrr s r startElementNSzXMLGenerator.startElementNSs" **,,, C$++d+++,,,3 1 1KFC 1 <==== MC/0000#% "[[]] J JMT5 KKKDKK$5$5$5$5y7G7G7GH I I I I  % *.D ' ' ' KK     rc|jr|dd|_dS|d||zdSr})r_rWrdr+r,rs r endElementNSzXMLGenerator.endElementNSsV  & 5 KK   */D ' ' ' KK$++d"3"33 4 4 4 4 4rc|rb|t|tst||j}|t |dSdSr))rhr?strr]rWrr+contents r characterszXMLGenerator.characterssg  )  . . 0 0 0gs++ 7gt~66 KKw ( ( ( ( (  ) )rc|rU|t|tst||j}||dSdSr))rhr?rr]rWrs r ignorableWhitespacez XMLGenerator.ignorableWhitespacesa  !  . . 0 0 0gs++ 7gt~66 KK  ! !rcf||d|d|ddS)Nz)rhrWr+targetrs r processingInstructionz"XMLGenerator.processingInstructions; **,,, 666444011111r)NrRF)F)r/r0r1rVrdrhrkrmrsrvr{rgrrrrrr5rr rQrQps , , , ,"0000(((777 """((($555)))!!!22222rrQceZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdS) XMLFilterBaseaYThis class is designed to sit between an XMLReader and the client application's event handlers. By default, it does nothing but pass requests up to the reader and events on to the handlers unmodified, but subclasses can override specific methods to modify the event stream or the configuration requests as they pass through.NcRtj|||_dSr))r XMLReaderrV_parentr+parents r rVzXMLFilterBase.__init__s$$$T*** rc:|j|dSr)) _err_handlererrorr+ exceptions r rzXMLFilterBase.errors  *****rc:|j|dSr))r fatalErrorrs r rzXMLFilterBase.fatalErrors $$Y/////rc:|j|dSr))rwarningrs r rzXMLFilterBase.warnings !!),,,,,rc:|j|dSr)) _cont_handlersetDocumentLocator)r+locators r rz XMLFilterBase.setDocumentLocators --g66666rc8|jdSr))rrkrjs r rkzXMLFilterBase.startDocuments ((*****rc8|jdSr))rrmrjs r rmzXMLFilterBase.endDocuments &&(((((rc<|j||dSr))rrsrqs r rsz XMLFilterBase.startPrefixMappings! --fc:::::rc:|j|dSr))rrvrus r rvzXMLFilterBase.endPrefixMappings ++F33333rc<|j||dSr))rr{)r+r,rzs r r{zXMLFilterBase.startElement ! ''e44444rc:|j|dSr))rrgr~s r rgzXMLFilterBase.endElements %%d+++++rc>|j|||dSr))rr)r+r,rrzs r rzXMLFilterBase.startElementNSs# ))$u=====rc<|j||dSr))rrrs r rzXMLFilterBase.endElementNSrrc:|j|dSr))rrrs r rzXMLFilterBase.characterss %%g.....rc:|j|dSr))rr)r+charss r rz!XMLFilterBase.ignorableWhitespaces ..u55555rc<|j||dSr))rrrs r rz#XMLFilterBase.processingInstructions! 00>>>>>rc:|j|dSr))r skippedEntityr~s r rzXMLFilterBase.skippedEntity s ((.....rc>|j|||dSr)) _dtd_handler notationDecl)r+r,publicIdsystemIds r rzXMLFilterBase.notationDecl%s# &&tXx@@@@@rc@|j||||dSr))runparsedEntityDecl)r+r,rrndatas r rz XMLFilterBase.unparsedEntityDecl(s% ,,T8XuMMMMMrc8|j||Sr)) _ent_handler resolveEntity)r+rrs r rzXMLFilterBase.resolveEntity-s ..xBBBrc |j||j||j||j||j|dSr))rsetContentHandlersetErrorHandlersetEntityResolver setDTDHandlerparse)r+sources r rzXMLFilterBase.parse2sv &&t,,, $$T*** &&t,,, ""4((( 6"""""rc:|j|dSr))r setLocale)r+locales r rzXMLFilterBase.setLocale9s v&&&&&rc6|j|Sr))r getFeaturer~s r rzXMLFilterBase.getFeature<s|&&t,,,rc<|j||dSr))r setFeature)r+r,states r rzXMLFilterBase.setFeature?s  e,,,,,rc6|j|Sr))r getPropertyr~s r rzXMLFilterBase.getPropertyBs|''---rc<|j||dSr))r setProperty)r+r,r s r rzXMLFilterBase.setPropertyEs    u-----rc|jSr)rrjs r getParentzXMLFilterBase.getParentJs |rc||_dSr)rrs r setParentzXMLFilterBase.setParentMs  rr)) r/r0r1__doc__rVrrrrrkrmrsrvr{rgrrrrrrrrrrrrrrrrrr5rr rrs +++000--- 777+++)));;;444555,,,>>>555///666???/// AAANNN CCC ###'''------...... rrct|tjrtj|}t|trt j|}nt|dr|}t j}t|dtr| |n| |t|dr4t|j tr| |j | C|.|}tjtj|}tj||}tj|r&| |t+|d}nd| t,j||t,j|}| ||S)zThis function takes an InputSource and an optional base URL and returns a fully resolved InputSource object ready for reading.readrr,Nrb)r?osPathLikefspathrr InputSourcehasattrrsetCharacterStream setByteStreamr, setSystemIdgetCharacterStream getByteStream getSystemIdpathdirnamenormpathjoinisfileopenurllibrurljoinrequesturlopen)rbasefsysidbasehead sysidfilenames r prepare_input_sourcerRs&"+&&#6""&# '&v..  ' &(( affQii % % $  % %a ( ( ( (   # # # 1f   '*QVS"9"9 '   qv & & &   ""*v/C/C/E/E/M""$$7??27#3#3D#9#9:: Xu55 7>>- ( ( =   } - - -]D))AA   v|33D%@@ A A A&&v'9'9';';<rs_ ('''''''''''      & & & & .'0'0'0Rp2p2p2p2p27)p2p2p2fkkkkkI'kkk^rPKN\j`(sax/__pycache__/__init__.cpython-311.pycnu[ !A?h:dZddlmZddlmZmZddlmZmZm Z m Z m Z efdZ efdZ dgZdZerdd lZdd lZdd lZejjs)d ejvr ejd d Z[d Zejd d dkrGejer-ejed ZddZejd d dkrdZndZ[d S)aSimple API for XML (SAX) implementation for Python. This module provides an implementation of the SAX 2 interface; information about the Java version of the interface can be found at http://www.megginson.com/SAX/. The Python version of the interface is documented at <...>. This package contains the following modules: handler -- Base classes and constants which define the SAX 2 API for the 'client-side' of SAX for Python. saxutils -- Implementation of the convenience classes commonly used to work with SAX. xmlreader -- Base classes and constants which define the SAX 2 API for the parsers used with SAX for Python. expatreader -- Driver that allows use of the Expat parser with SAX. ) InputSource)ContentHandler ErrorHandler) SAXExceptionSAXNotRecognizedExceptionSAXParseExceptionSAXNotSupportedExceptionSAXReaderNotAvailablect}||||||dS)N) make_parsersetContentHandlersetErrorHandlerparse)sourcehandler errorHandlerparsers =/opt/alt/python-internal/lib64/python3.11/xml/sax/__init__.pyrrsK ]]F W%%% <((( LLcddl}|t}t}||||t }t |tr)|| |n(| | || |dS)N) iorr r rr isinstancestrsetCharacterStreamStringIO setByteStreamBytesIOr)stringrrrrinpsrcs r parseStringr!#s III#~~ ]]F W%%% <((( ]]F&#1!!"++f"5"56666RZZ//000 LLrzxml.sax.expatreaderrN PY_SAX_PARSER,zpython.xml.sax.parserjavact|tzD]<} t|cS#t$rddl}||jvrY.t $rY9wxYwt dd)a3Creates and returns a SAX parser. Creates the first parser it is able to instantiate of the ones given in the iterable created by chaining parser_list and default_parser_list. The iterables must contain the names of Python modules containing both a SAX parser and a create_parser function.rNzNo parsers found)listdefault_parser_list_create_parser ImportErrorsysmodulesr ) parser_list parser_namer,s rr r FsK((+>>    !+.. . . .    JJJck))*)%    D  2D 9 99s,A AAc|ddlm}||dt}|S)Nr)imp)org.python.corer1 importNameglobals create_parser)r/r1 drv_modules rr*r*as?''''''^^KGII>> '')))rcPt|iidg}|S)Nr5) __import__r5)r/r6s rr*r*gs* Br?2CDD '')))r)r&)__doc__ xmlreaderrrrr _exceptionsrrrr r rr!r)_falsexml.sax.expatreaderxmlosr,flagsignore_environmentenvironsplit_keyplatformregistry containsKey getPropertyr r*r&rrrIs*#"""""11111111.............. )5  /;lnn    $--   y#A2:(E(E*_5;;C@@<v#,":":4"@"@,22488>>sCC::::4<1**** ***CCrPKN\oQQ)sax/__pycache__/xmlreader.cpython-311.pycnu[ !A?h1dZddlmZddlmZmZGddZGddeZGdd ZGd d Z Gd d Z Gdde Z dZ e dkr e dSdS)z]An XML Reader is the SAX 2 name for an XML parser. XML Parsers should be based on this code. )handler)SAXNotSupportedExceptionSAXNotRecognizedExceptioncleZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdZdS) XMLReadera%Interface for reading an XML document using callbacks. XMLReader is the interface that an XML parser's SAX2 driver must implement. This interface allows an application to set and query features and properties in the parser, to register event handlers for document processing, and to initiate a document parse. All SAX interfaces are assumed to be synchronous: the parse methods must not return until parsing is complete, and readers must wait for an event-handler callback to return before reporting the next event.ctj|_tj|_tj|_tj|_dSN) rContentHandler _cont_handler DTDHandler _dtd_handlerEntityResolver _ent_handler ErrorHandler _err_handlerselfs >/opt/alt/python-internal/lib64/python3.11/xml/sax/xmlreader.py__init__zXMLReader.__init__sL$355#.00#244#022c td)zAParse an XML document from a system identifier or an InputSource. This method must be implemented!NotImplementedErrorrsources rparsezXMLReader.parses!"DEEErc|jS)z#Returns the current ContentHandler.r rs rgetContentHandlerzXMLReader.getContentHandler"s !!rc||_dS)z:Registers a new object to receive document content events.Nrrrs rsetContentHandlerzXMLReader.setContentHandler&s$rc|jS)z Returns the current DTD handler.r rs r getDTDHandlerzXMLReader.getDTDHandler*   rc||_dS)z7Register an object to receive basic DTD-related events.Nr%r"s r setDTDHandlerzXMLReader.setDTDHandler.#rc|jS)z#Returns the current EntityResolver.rrs rgetEntityResolverzXMLReader.getEntityResolver2r'rc||_dS)z0Register an object to resolve external entities.Nr,)rresolvers rsetEntityResolverzXMLReader.setEntityResolver6s$rc|jS)z!Returns the current ErrorHandler.rrs rgetErrorHandlerzXMLReader.getErrorHandler:r'rc||_dS)z3Register an object to receive error-message events.Nr2r"s rsetErrorHandlerzXMLReader.setErrorHandler>r*rc td)aHAllow an application to set the locale for errors and warnings. SAX parsers are not required to provide localization for errors and warnings; if they cannot support the requested locale, however, they must raise a SAX exception. Applications may request a locale change in the middle of a parse.zLocale support not implemented)r)rlocales r setLocalezXMLReader.setLocaleBs''GHHHrc&td|z)z1Looks up and returns the state of a SAX2 feature.Feature '%s' not recognizedrrnames r getFeaturezXMLReader.getFeatureK'(E(LMMMrc&td|z)z!Sets the state of a SAX2 feature.r:r;)rr=states r setFeaturezXMLReader.setFeatureOr?rc&td|z)z2Looks up and returns the value of a SAX2 property.Property '%s' not recognizedr;r<s r getPropertyzXMLReader.getPropertyS'(F(MNNNrc&td|z)z"Sets the value of a SAX2 property.rDr;)rr=values r setPropertyzXMLReader.setPropertyWrFrN)__name__ __module__ __qualname____doc__rrr r#r&r)r-r0r3r5r8r>rBrErIrrrr s  333 FFF"""%%%!!!$$$!!!%%%!!!$$$IIINNNNNNOOOOOOOOrrc8eZdZdZd dZdZdZdZdZdZ d S) IncrementalParserasThis interface adds three extra methods to the XMLReader interface that allow XML parsers to support incremental parsing. Support for this interface is optional, since not all underlying XML parsers support this functionality. When the parser is instantiated it is ready to begin accepting data from the feed method immediately. After parsing has been finished with a call to close the reset method must be called to make the parser ready to accept new data, either from feed or using the parse method. Note that these methods must _not_ be called during parsing, that is, after parse has been called and before it returns. By default, the class also implements the parse method of the XMLReader interface using the feed, close and reset methods of the IncrementalParser interface as a convenience to SAX 2.0 driver writers.cH||_t|dSr )_bufsizerr)rbufsizes rrzIncrementalParser.__init__os# 4     rc|ddlm}||}|||}||}||j}|r1||||j}|1| dS)Nr)saxutils) rVprepare_input_source prepareParsergetCharacterStream getByteStreamreadrSfeedclose)rrrVfilebuffers rrzIncrementalParser.parsess..v66 6"""((** <''))D4=)) . IIf   YYt}--F . rc td)aThis method gives the raw XML data in the data parameter to the parser and makes it parse the data, emitting the corresponding events. It is allowed for XML constructs to be split across several calls to feed. feed may raise SAXException.rr)rdatas rr]zIncrementalParser.feeds""DEEErc td)ztThis method is called by the parse implementation to allow the SAX 2.0 driver to prepare itself for parsing.z!prepareParser must be overridden!rrs rrYzIncrementalParser.prepareParsers""EFFFrc td)aThis method is called when the entire XML document has been passed to the parser through the feed method, to notify the parser that there are no more data. This allows the parser to do the final checks on the document and empty the internal data buffer. The parser will not be ready to parse another document until the reset method has been called. close may raise SAXException.rrrs rr^zIncrementalParser.closes""DEEErc td)zThis method is called after close has been called to reset the parser so that it is ready to parse new documents. The results of calling parse or feed after close without calling reset are undefined.rrrs rresetzIncrementalParser.resets ""DEEErN)rQ) rJrKrLrMrrr]rYr^rfrNrrrPrP[s&!!!!   FFFGGG F F FFFFFFrrPc*eZdZdZdZdZdZdZdS)LocatorzInterface for associating a SAX event with a document location. A locator object will return valid results only during calls to DocumentHandler methods; at any other time, the results are unpredictable.cdS)z6Return the column number where the current event ends.rNrs rgetColumnNumberzLocator.getColumnNumberrrcdS)z4Return the line number where the current event ends.rjrNrs r getLineNumberzLocator.getLineNumberrlrcdS)z3Return the public identifier for the current event.NrNrs r getPublicIdzLocator.getPublicIdtrcdS)z3Return the system identifier for the current event.NrNrs r getSystemIdzLocator.getSystemIdrqrN)rJrKrLrMrkrnrprsrNrrrhrhsZ"" rrhcVeZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdS) InputSourceanEncapsulation of the information needed by the XMLReader to read entities. This class may include information about the public identifier, system identifier, byte stream (possibly with character encoding information) and/or the character stream of an entity. Applications will create objects of this class for use in the XMLReader.parse method and for returning from EntityResolver.resolveEntity. An InputSource belongs to the application, the XMLReader is not allowed to modify InputSource objects passed to it from the application, although it may make copies and modify those.NcL||_d|_d|_d|_d|_dSr )_InputSource__system_id_InputSource__public_id_InputSource__encoding_InputSource__bytefile_InputSource__charfiler system_ids rrzInputSource.__init__s+$rc||_dS)z/Sets the public identifier of this InputSource.Nrx)r public_ids r setPublicIdzInputSource.setPublicId$rc|jS)z2Returns the public identifier of this InputSource.rrs rrpzInputSource.getPublicId rc||_dS)z/Sets the system identifier of this InputSource.Nrwr|s r setSystemIdzInputSource.setSystemIdrrc|jS)z2Returns the system identifier of this InputSource.rrs rrszInputSource.getSystemIdrrc||_dS)a4Sets the character encoding of this InputSource. The encoding must be a string acceptable for an XML encoding declaration (see section 4.3.3 of the XML recommendation). The encoding attribute of the InputSource is ignored if the InputSource also contains a character stream.Nry)rencodings r setEncodingzInputSource.setEncoding#rc|jS)z/Get the character encoding of this InputSource.rrs r getEncodingzInputSource.getEncoding rc||_dS)aSet the byte stream (a Python file-like object which does not perform byte-to-character conversion) for this input source. The SAX parser will ignore this if there is also a character stream specified, but it will use a byte stream in preference to opening a URI connection itself. If the application knows the character encoding of the byte stream, it should set it with the setEncoding method.Nrz)rbytefiles r setByteStreamzInputSource.setByteStreams#rc|jS)zGet the byte stream for this input source. The getEncoding method will return the character encoding for this byte stream, or None if unknown.rrs rr[zInputSource.getByteStreams rc||_dS)a^Set the character stream for this input source. (The stream must be a Python 2.0 Unicode-wrapped file-like that performs conversion to Unicode strings.) If there is a character stream specified, the SAX parser will ignore any byte stream and will not attempt to open a URI connection to the system identifier.Nr{)rcharfiles rsetCharacterStreamzInputSource.setCharacterStreamrrc|jS)z/Get the character stream for this input source.rrs rrZzInputSource.getCharacterStreamrrr )rJrKrLrMrrrprrsrrrr[rrZrNrrrurus B B    %%%   %%%   ### # # ####rrucveZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZddZdZdZdZdS)AttributesImplc||_dS)zQNon-NS-aware implementation. attrs should be of the form {name : value}.N_attrs)rattrss rrzAttributesImpl.__init__s rc*t|jSr lenrrs r getLengthzAttributesImpl.getLength4;rcdS)NCDATArNr<s rgetTypezAttributesImpl.getType!swrc|j|Sr rr<s rgetValuezAttributesImpl.getValue${4  rc|j|Sr rr<s rgetValueByQNamezAttributesImpl.getValueByQName'rrc6||jvrt||Sr rKeyErrorr<s rgetNameByQNamezAttributesImpl.getNameByQName* t{ " "4..  rc6||jvrt||Sr rr<s rgetQNameByNamezAttributesImpl.getQNameByName/rrcNt|jSr listrkeysrs rgetNameszAttributesImpl.getNames4DK$$&&'''rcNt|jSr rrs r getQNameszAttributesImpl.getQNames7rrc*t|jSr rrs r__len__zAttributesImpl.__len__:rrc|j|Sr rr<s r __getitem__zAttributesImpl.__getitem__=rrcNt|jSr rrs rrzAttributesImpl.keys@rrc||jvSr rr<s r __contains__zAttributesImpl.__contains__Cst{""rNc8|j||Sr )rget)rr= alternatives rrzAttributesImpl.getFs{t[111rc6||jSr ) __class__rrs rcopyzAttributesImpl.copyIs~~dk***rcNt|jSr )rritemsrs rrzAttributesImpl.itemsLsDK%%''(((rcNt|jSr )rrvaluesrs rrzAttributesImpl.valuesOsDK&&(()))rr )rJrKrLrrrrrrrrrrrrrrrrrrNrrrrs    !!!!!!  ((((((   !!!(((###2222+++)))*****rrc2eZdZdZdZdZdZdZdZdS)AttributesNSImplc"||_||_dS)zNS-aware implementation. attrs should be of the form {(ns_uri, lname): value, ...}. qnames of the form {(ns_uri, lname): qname, ...}.N)r_qnames)rrqnamess rrzAttributesNSImpl.__init__Vs   rc|jD]\}}||kr|j|cSt|r )rrrrrr=nsnameqnames rrz AttributesNSImpl.getValueByQName^sR#|1133 + +OVU}}{6****tnnrcr|jD]\}}||kr|cSt|r )rrrrs rrzAttributesNSImpl.getNameByQNameesH#|1133  OVU}} tnnrc|j|Sr )rr<s rrzAttributesNSImpl.getQNameByNamels|D!!rcNt|jSr )rrrrs rrzAttributesNSImpl.getQNamesosDL''))***rcB||j|jSr )rrrrs rrzAttributesNSImpl.copyrs~~dk4<888rN) rJrKrLrrrrrrrNrrrrTsn"""+++99999rrcZtttdSr )rrPrhrNrr_testrvs$ KKK IIIIIr__main__N)rMrWr _exceptionsrrrrPrhrurrrrJrNrrrs""LLLLLLLL NONONONONONONONO`FFFFFFFFFF FFFFFFT0UUUUUUUUr:*:*:*:*:*:*:*:*|99999~999D  z EGGGGGrPKN\j`.sax/__pycache__/__init__.cpython-311.opt-1.pycnu[ !A?h:dZddlmZddlmZmZddlmZmZm Z m Z m Z efdZ efdZ dgZdZerdd lZdd lZdd lZejjs)d ejvr ejd d Z[d Zejd d dkrGejer-ejed ZddZejd d dkrdZndZ[d S)aSimple API for XML (SAX) implementation for Python. This module provides an implementation of the SAX 2 interface; information about the Java version of the interface can be found at http://www.megginson.com/SAX/. The Python version of the interface is documented at <...>. This package contains the following modules: handler -- Base classes and constants which define the SAX 2 API for the 'client-side' of SAX for Python. saxutils -- Implementation of the convenience classes commonly used to work with SAX. xmlreader -- Base classes and constants which define the SAX 2 API for the parsers used with SAX for Python. expatreader -- Driver that allows use of the Expat parser with SAX. ) InputSource)ContentHandler ErrorHandler) SAXExceptionSAXNotRecognizedExceptionSAXParseExceptionSAXNotSupportedExceptionSAXReaderNotAvailablect}||||||dS)N) make_parsersetContentHandlersetErrorHandlerparse)sourcehandler errorHandlerparsers =/opt/alt/python-internal/lib64/python3.11/xml/sax/__init__.pyrrsK ]]F W%%% <((( LLcddl}|t}t}||||t }t |tr)|| |n(| | || |dS)N) iorr r rr isinstancestrsetCharacterStreamStringIO setByteStreamBytesIOr)stringrrrrinpsrcs r parseStringr!#s III#~~ ]]F W%%% <((( ]]F&#1!!"++f"5"56666RZZ//000 LLrzxml.sax.expatreaderrN PY_SAX_PARSER,zpython.xml.sax.parserjavact|tzD]<} t|cS#t$rddl}||jvrY.t $rY9wxYwt dd)a3Creates and returns a SAX parser. Creates the first parser it is able to instantiate of the ones given in the iterable created by chaining parser_list and default_parser_list. The iterables must contain the names of Python modules containing both a SAX parser and a create_parser function.rNzNo parsers found)listdefault_parser_list_create_parser ImportErrorsysmodulesr ) parser_list parser_namer,s rr r FsK((+>>    !+.. . . .    JJJck))*)%    D  2D 9 99s,A AAc|ddlm}||dt}|S)Nr)imp)org.python.corer1 importNameglobals create_parser)r/r1 drv_modules rr*r*as?''''''^^KGII>> '')))rcPt|iidg}|S)Nr5) __import__r5)r/r6s rr*r*gs* Br?2CDD '')))r)r&)__doc__ xmlreaderrrrr _exceptionsrrrr r rr!r)_falsexml.sax.expatreaderxmlosr,flagsignore_environmentenvironsplit_keyplatformregistry containsKey getPropertyr r*r&rrrIs*#"""""11111111.............. )5  /;lnn    $--   y#A2:(E(E*_5;;C@@<v#,":":4"@"@,22488>>sCC::::4<1**** ***CCrPKN\]1S?S?sax/expatreader.pynu[""" SAX driver for the pyexpat C module. This driver works with pyexpat.__version__ == '2.22'. """ version = "0.20" from xml.sax._exceptions import * from xml.sax.handler import feature_validation, feature_namespaces from xml.sax.handler import feature_namespace_prefixes from xml.sax.handler import feature_external_ges, feature_external_pes from xml.sax.handler import feature_string_interning from xml.sax.handler import property_xml_string, property_interning_dict # xml.parsers.expat does not raise ImportError in Jython import sys if sys.platform[:4] == "java": raise SAXReaderNotAvailable("expat not available in Java", None) del sys try: from xml.parsers import expat except ImportError: raise SAXReaderNotAvailable("expat not supported", None) else: if not hasattr(expat, "ParserCreate"): raise SAXReaderNotAvailable("expat not supported", None) from xml.sax import xmlreader, saxutils, handler AttributesImpl = xmlreader.AttributesImpl AttributesNSImpl = xmlreader.AttributesNSImpl # If we're using a sufficiently recent version of Python, we can use # weak references to avoid cycles between the parser and content # handler, otherwise we'll just have to pretend. try: import _weakref except ImportError: def _mkproxy(o): return o else: import weakref _mkproxy = weakref.proxy del weakref, _weakref class _ClosedParser: pass # --- ExpatLocator class ExpatLocator(xmlreader.Locator): """Locator for use with the ExpatParser class. This uses a weak reference to the parser object to avoid creating a circular reference between the parser and the content handler. """ def __init__(self, parser): self._ref = _mkproxy(parser) def getColumnNumber(self): parser = self._ref if parser._parser is None: return None return parser._parser.ErrorColumnNumber def getLineNumber(self): parser = self._ref if parser._parser is None: return 1 return parser._parser.ErrorLineNumber def getPublicId(self): parser = self._ref if parser is None: return None return parser._source.getPublicId() def getSystemId(self): parser = self._ref if parser is None: return None return parser._source.getSystemId() # --- ExpatParser class ExpatParser(xmlreader.IncrementalParser, xmlreader.Locator): """SAX driver for the pyexpat C module.""" def __init__(self, namespaceHandling=0, bufsize=2**16-20): xmlreader.IncrementalParser.__init__(self, bufsize) self._source = xmlreader.InputSource() self._parser = None self._namespaces = namespaceHandling self._lex_handler_prop = None self._parsing = False self._entity_stack = [] self._external_ges = 0 self._interning = None # XMLReader methods def parse(self, source): "Parse an XML document from a URL or an InputSource." source = saxutils.prepare_input_source(source) self._source = source try: self.reset() self._cont_handler.setDocumentLocator(ExpatLocator(self)) xmlreader.IncrementalParser.parse(self, source) except: # bpo-30264: Close the source on error to not leak resources: # xml.sax.parse() doesn't give access to the underlying parser # to the caller self._close_source() raise def prepareParser(self, source): if source.getSystemId() is not None: self._parser.SetBase(source.getSystemId()) # Redefined setContentHandler to allow changing handlers during parsing def setContentHandler(self, handler): xmlreader.IncrementalParser.setContentHandler(self, handler) if self._parsing: self._reset_cont_handler() def getFeature(self, name): if name == feature_namespaces: return self._namespaces elif name == feature_string_interning: return self._interning is not None elif name in (feature_validation, feature_external_pes, feature_namespace_prefixes): return 0 elif name == feature_external_ges: return self._external_ges raise SAXNotRecognizedException("Feature '%s' not recognized" % name) def setFeature(self, name, state): if self._parsing: raise SAXNotSupportedException("Cannot set features while parsing") if name == feature_namespaces: self._namespaces = state elif name == feature_external_ges: self._external_ges = state elif name == feature_string_interning: if state: if self._interning is None: self._interning = {} else: self._interning = None elif name == feature_validation: if state: raise SAXNotSupportedException( "expat does not support validation") elif name == feature_external_pes: if state: raise SAXNotSupportedException( "expat does not read external parameter entities") elif name == feature_namespace_prefixes: if state: raise SAXNotSupportedException( "expat does not report namespace prefixes") else: raise SAXNotRecognizedException( "Feature '%s' not recognized" % name) def getProperty(self, name): if name == handler.property_lexical_handler: return self._lex_handler_prop elif name == property_interning_dict: return self._interning elif name == property_xml_string: if self._parser: if hasattr(self._parser, "GetInputContext"): return self._parser.GetInputContext() else: raise SAXNotRecognizedException( "This version of expat does not support getting" " the XML string") else: raise SAXNotSupportedException( "XML string cannot be returned when not parsing") raise SAXNotRecognizedException("Property '%s' not recognized" % name) def setProperty(self, name, value): if name == handler.property_lexical_handler: self._lex_handler_prop = value if self._parsing: self._reset_lex_handler_prop() elif name == property_interning_dict: self._interning = value elif name == property_xml_string: raise SAXNotSupportedException("Property '%s' cannot be set" % name) else: raise SAXNotRecognizedException("Property '%s' not recognized" % name) # IncrementalParser methods def feed(self, data, isFinal=False): if not self._parsing: self.reset() self._parsing = True self._cont_handler.startDocument() try: # The isFinal parameter is internal to the expat reader. # If it is set to true, expat will check validity of the entire # document. When feeding chunks, they are not normally final - # except when invoked from close. self._parser.Parse(data, isFinal) except expat.error as e: exc = SAXParseException(expat.ErrorString(e.code), e, self) # FIXME: when to invoke error()? self._err_handler.fatalError(exc) def flush(self): if self._parser is None: return was_enabled = self._parser.GetReparseDeferralEnabled() try: self._parser.SetReparseDeferralEnabled(False) self._parser.Parse(b"", False) except expat.error as e: exc = SAXParseException(expat.ErrorString(e.code), e, self) self._err_handler.fatalError(exc) finally: self._parser.SetReparseDeferralEnabled(was_enabled) def _close_source(self): source = self._source try: file = source.getCharacterStream() if file is not None: file.close() finally: file = source.getByteStream() if file is not None: file.close() def close(self): if (self._entity_stack or self._parser is None or isinstance(self._parser, _ClosedParser)): # If we are completing an external entity, do nothing here return try: self.feed(b"", isFinal=True) self._cont_handler.endDocument() self._parsing = False # break cycle created by expat handlers pointing to our methods self._parser = None finally: self._parsing = False if self._parser is not None: # Keep ErrorColumnNumber and ErrorLineNumber after closing. parser = _ClosedParser() parser.ErrorColumnNumber = self._parser.ErrorColumnNumber parser.ErrorLineNumber = self._parser.ErrorLineNumber self._parser = parser self._close_source() def _reset_cont_handler(self): self._parser.ProcessingInstructionHandler = \ self._cont_handler.processingInstruction self._parser.CharacterDataHandler = self._cont_handler.characters def _reset_lex_handler_prop(self): lex = self._lex_handler_prop parser = self._parser if lex is None: parser.CommentHandler = None parser.StartCdataSectionHandler = None parser.EndCdataSectionHandler = None parser.StartDoctypeDeclHandler = None parser.EndDoctypeDeclHandler = None else: parser.CommentHandler = lex.comment parser.StartCdataSectionHandler = lex.startCDATA parser.EndCdataSectionHandler = lex.endCDATA parser.StartDoctypeDeclHandler = self.start_doctype_decl parser.EndDoctypeDeclHandler = lex.endDTD def reset(self): if self._namespaces: self._parser = expat.ParserCreate(self._source.getEncoding(), " ", intern=self._interning) self._parser.namespace_prefixes = 1 self._parser.StartElementHandler = self.start_element_ns self._parser.EndElementHandler = self.end_element_ns else: self._parser = expat.ParserCreate(self._source.getEncoding(), intern = self._interning) self._parser.StartElementHandler = self.start_element self._parser.EndElementHandler = self.end_element self._reset_cont_handler() self._parser.UnparsedEntityDeclHandler = self.unparsed_entity_decl self._parser.NotationDeclHandler = self.notation_decl self._parser.StartNamespaceDeclHandler = self.start_namespace_decl self._parser.EndNamespaceDeclHandler = self.end_namespace_decl self._decl_handler_prop = None if self._lex_handler_prop: self._reset_lex_handler_prop() # self._parser.DefaultHandler = # self._parser.DefaultHandlerExpand = # self._parser.NotStandaloneHandler = self._parser.ExternalEntityRefHandler = self.external_entity_ref try: self._parser.SkippedEntityHandler = self.skipped_entity_handler except AttributeError: # This pyexpat does not support SkippedEntity pass self._parser.SetParamEntityParsing( expat.XML_PARAM_ENTITY_PARSING_UNLESS_STANDALONE) self._parsing = False self._entity_stack = [] # Locator methods def getColumnNumber(self): if self._parser is None: return None return self._parser.ErrorColumnNumber def getLineNumber(self): if self._parser is None: return 1 return self._parser.ErrorLineNumber def getPublicId(self): return self._source.getPublicId() def getSystemId(self): return self._source.getSystemId() # event handlers def start_element(self, name, attrs): self._cont_handler.startElement(name, AttributesImpl(attrs)) def end_element(self, name): self._cont_handler.endElement(name) def start_element_ns(self, name, attrs): pair = name.split() if len(pair) == 1: # no namespace pair = (None, name) elif len(pair) == 3: pair = pair[0], pair[1] else: # default namespace pair = tuple(pair) newattrs = {} qnames = {} for (aname, value) in attrs.items(): parts = aname.split() length = len(parts) if length == 1: # no namespace qname = aname apair = (None, aname) elif length == 3: qname = "%s:%s" % (parts[2], parts[1]) apair = parts[0], parts[1] else: # default namespace qname = parts[1] apair = tuple(parts) newattrs[apair] = value qnames[apair] = qname self._cont_handler.startElementNS(pair, None, AttributesNSImpl(newattrs, qnames)) def end_element_ns(self, name): pair = name.split() if len(pair) == 1: pair = (None, name) elif len(pair) == 3: pair = pair[0], pair[1] else: pair = tuple(pair) self._cont_handler.endElementNS(pair, None) # this is not used (call directly to ContentHandler) def processing_instruction(self, target, data): self._cont_handler.processingInstruction(target, data) # this is not used (call directly to ContentHandler) def character_data(self, data): self._cont_handler.characters(data) def start_namespace_decl(self, prefix, uri): self._cont_handler.startPrefixMapping(prefix, uri) def end_namespace_decl(self, prefix): self._cont_handler.endPrefixMapping(prefix) def start_doctype_decl(self, name, sysid, pubid, has_internal_subset): self._lex_handler_prop.startDTD(name, pubid, sysid) def unparsed_entity_decl(self, name, base, sysid, pubid, notation_name): self._dtd_handler.unparsedEntityDecl(name, pubid, sysid, notation_name) def notation_decl(self, name, base, sysid, pubid): self._dtd_handler.notationDecl(name, pubid, sysid) def external_entity_ref(self, context, base, sysid, pubid): if not self._external_ges: return 1 source = self._ent_handler.resolveEntity(pubid, sysid) source = saxutils.prepare_input_source(source, self._source.getSystemId() or "") self._entity_stack.append((self._parser, self._source)) self._parser = self._parser.ExternalEntityParserCreate(context) self._source = source try: xmlreader.IncrementalParser.parse(self, source) except: return 0 # FIXME: save error info here? (self._parser, self._source) = self._entity_stack[-1] del self._entity_stack[-1] return 1 def skipped_entity_handler(self, name, is_pe): if is_pe: # The SAX spec requires to report skipped PEs with a '%' name = '%'+name self._cont_handler.skippedEntity(name) # --- def create_parser(*args, **kwargs): return ExpatParser(*args, **kwargs) # --- if __name__ == "__main__": import xml.sax.saxutils p = create_parser() p.setContentHandler(xml.sax.saxutils.XMLGenerator()) p.setErrorHandler(xml.sax.ErrorHandler()) p.parse("http://www.ibiblio.org/xml/examples/shakespeare/hamlet.xml") PKN\Z'::sax/__init__.pynu["""Simple API for XML (SAX) implementation for Python. This module provides an implementation of the SAX 2 interface; information about the Java version of the interface can be found at http://www.megginson.com/SAX/. The Python version of the interface is documented at <...>. This package contains the following modules: handler -- Base classes and constants which define the SAX 2 API for the 'client-side' of SAX for Python. saxutils -- Implementation of the convenience classes commonly used to work with SAX. xmlreader -- Base classes and constants which define the SAX 2 API for the parsers used with SAX for Python. expatreader -- Driver that allows use of the Expat parser with SAX. """ from .xmlreader import InputSource from .handler import ContentHandler, ErrorHandler from ._exceptions import SAXException, SAXNotRecognizedException, \ SAXParseException, SAXNotSupportedException, \ SAXReaderNotAvailable def parse(source, handler, errorHandler=ErrorHandler()): parser = make_parser() parser.setContentHandler(handler) parser.setErrorHandler(errorHandler) parser.parse(source) def parseString(string, handler, errorHandler=ErrorHandler()): import io if errorHandler is None: errorHandler = ErrorHandler() parser = make_parser() parser.setContentHandler(handler) parser.setErrorHandler(errorHandler) inpsrc = InputSource() if isinstance(string, str): inpsrc.setCharacterStream(io.StringIO(string)) else: inpsrc.setByteStream(io.BytesIO(string)) parser.parse(inpsrc) # this is the parser list used by the make_parser function if no # alternatives are given as parameters to the function default_parser_list = ["xml.sax.expatreader"] # tell modulefinder that importing sax potentially imports expatreader _false = 0 if _false: import xml.sax.expatreader import os, sys if not sys.flags.ignore_environment and "PY_SAX_PARSER" in os.environ: default_parser_list = os.environ["PY_SAX_PARSER"].split(",") del os _key = "python.xml.sax.parser" if sys.platform[:4] == "java" and sys.registry.containsKey(_key): default_parser_list = sys.registry.getProperty(_key).split(",") def make_parser(parser_list=()): """Creates and returns a SAX parser. Creates the first parser it is able to instantiate of the ones given in the iterable created by chaining parser_list and default_parser_list. The iterables must contain the names of Python modules containing both a SAX parser and a create_parser function.""" for parser_name in list(parser_list) + default_parser_list: try: return _create_parser(parser_name) except ImportError: import sys if parser_name in sys.modules: # The parser module was found, but importing it # failed unexpectedly, pass this exception through raise except SAXReaderNotAvailable: # The parser module detected that it won't work properly, # so try the next one pass raise SAXReaderNotAvailable("No parsers found", None) # --- Internal utility methods used by make_parser if sys.platform[ : 4] == "java": def _create_parser(parser_name): from org.python.core import imp drv_module = imp.importName(parser_name, 0, globals()) return drv_module.create_parser() else: def _create_parser(parser_name): drv_module = __import__(parser_name,{},{},['create_parser']) return drv_module.create_parser() del sys PKN\ddom/expatbuilder.pynu["""Facility to use the Expat parser to load a minidom instance from a string or file. This avoids all the overhead of SAX and pulldom to gain performance. """ # Warning! # # This module is tightly bound to the implementation details of the # minidom DOM and can't be used with other DOM implementations. This # is due, in part, to a lack of appropriate methods in the DOM (there is # no way to create Entity and Notation nodes via the DOM Level 2 # interface), and for performance. The latter is the cause of some fairly # cryptic code. # # Performance hacks: # # - .character_data_handler() has an extra case in which continuing # data is appended to an existing Text node; this can be a # speedup since pyexpat can break up character data into multiple # callbacks even though we set the buffer_text attribute on the # parser. This also gives us the advantage that we don't need a # separate normalization pass. # # - Determining that a node exists is done using an identity comparison # with None rather than a truth test; this avoids searching for and # calling any methods on the node object if it exists. (A rather # nice speedup is achieved this way as well!) from xml.dom import xmlbuilder, minidom, Node from xml.dom import EMPTY_NAMESPACE, EMPTY_PREFIX, XMLNS_NAMESPACE from xml.parsers import expat from xml.dom.minidom import _append_child, _set_attribute_node from xml.dom.NodeFilter import NodeFilter TEXT_NODE = Node.TEXT_NODE CDATA_SECTION_NODE = Node.CDATA_SECTION_NODE DOCUMENT_NODE = Node.DOCUMENT_NODE FILTER_ACCEPT = xmlbuilder.DOMBuilderFilter.FILTER_ACCEPT FILTER_REJECT = xmlbuilder.DOMBuilderFilter.FILTER_REJECT FILTER_SKIP = xmlbuilder.DOMBuilderFilter.FILTER_SKIP FILTER_INTERRUPT = xmlbuilder.DOMBuilderFilter.FILTER_INTERRUPT theDOMImplementation = minidom.getDOMImplementation() # Expat typename -> TypeInfo _typeinfo_map = { "CDATA": minidom.TypeInfo(None, "cdata"), "ENUM": minidom.TypeInfo(None, "enumeration"), "ENTITY": minidom.TypeInfo(None, "entity"), "ENTITIES": minidom.TypeInfo(None, "entities"), "ID": minidom.TypeInfo(None, "id"), "IDREF": minidom.TypeInfo(None, "idref"), "IDREFS": minidom.TypeInfo(None, "idrefs"), "NMTOKEN": minidom.TypeInfo(None, "nmtoken"), "NMTOKENS": minidom.TypeInfo(None, "nmtokens"), } class ElementInfo(object): __slots__ = '_attr_info', '_model', 'tagName' def __init__(self, tagName, model=None): self.tagName = tagName self._attr_info = [] self._model = model def __getstate__(self): return self._attr_info, self._model, self.tagName def __setstate__(self, state): self._attr_info, self._model, self.tagName = state def getAttributeType(self, aname): for info in self._attr_info: if info[1] == aname: t = info[-2] if t[0] == "(": return _typeinfo_map["ENUM"] else: return _typeinfo_map[info[-2]] return minidom._no_type def getAttributeTypeNS(self, namespaceURI, localName): return minidom._no_type def isElementContent(self): if self._model: type = self._model[0] return type not in (expat.model.XML_CTYPE_ANY, expat.model.XML_CTYPE_MIXED) else: return False def isEmpty(self): if self._model: return self._model[0] == expat.model.XML_CTYPE_EMPTY else: return False def isId(self, aname): for info in self._attr_info: if info[1] == aname: return info[-2] == "ID" return False def isIdNS(self, euri, ename, auri, aname): # not sure this is meaningful return self.isId((auri, aname)) def _intern(builder, s): return builder._intern_setdefault(s, s) def _parse_ns_name(builder, name): assert ' ' in name parts = name.split(' ') intern = builder._intern_setdefault if len(parts) == 3: uri, localname, prefix = parts prefix = intern(prefix, prefix) qname = "%s:%s" % (prefix, localname) qname = intern(qname, qname) localname = intern(localname, localname) elif len(parts) == 2: uri, localname = parts prefix = EMPTY_PREFIX qname = localname = intern(localname, localname) else: raise ValueError("Unsupported syntax: spaces in URIs not supported: %r" % name) return intern(uri, uri), localname, prefix, qname class ExpatBuilder: """Document builder that uses Expat to build a ParsedXML.DOM document instance.""" def __init__(self, options=None): if options is None: options = xmlbuilder.Options() self._options = options if self._options.filter is not None: self._filter = FilterVisibilityController(self._options.filter) else: self._filter = None # This *really* doesn't do anything in this case, so # override it with something fast & minimal. self._finish_start_element = id self._parser = None self.reset() def createParser(self): """Create a new parser object.""" return expat.ParserCreate() def getParser(self): """Return the parser object, creating a new one if needed.""" if not self._parser: self._parser = self.createParser() self._intern_setdefault = self._parser.intern.setdefault self._parser.buffer_text = True self._parser.ordered_attributes = True self._parser.specified_attributes = True self.install(self._parser) return self._parser def reset(self): """Free all data structures used during DOM construction.""" self.document = theDOMImplementation.createDocument( EMPTY_NAMESPACE, None, None) self.curNode = self.document self._elem_info = self.document._elem_info self._cdata = False def install(self, parser): """Install the callbacks needed to build the DOM into the parser.""" # This creates circular references! parser.StartDoctypeDeclHandler = self.start_doctype_decl_handler parser.StartElementHandler = self.first_element_handler parser.EndElementHandler = self.end_element_handler parser.ProcessingInstructionHandler = self.pi_handler if self._options.entities: parser.EntityDeclHandler = self.entity_decl_handler parser.NotationDeclHandler = self.notation_decl_handler if self._options.comments: parser.CommentHandler = self.comment_handler if self._options.cdata_sections: parser.StartCdataSectionHandler = self.start_cdata_section_handler parser.EndCdataSectionHandler = self.end_cdata_section_handler parser.CharacterDataHandler = self.character_data_handler_cdata else: parser.CharacterDataHandler = self.character_data_handler parser.ExternalEntityRefHandler = self.external_entity_ref_handler parser.XmlDeclHandler = self.xml_decl_handler parser.ElementDeclHandler = self.element_decl_handler parser.AttlistDeclHandler = self.attlist_decl_handler def parseFile(self, file): """Parse a document from a file object, returning the document node.""" parser = self.getParser() first_buffer = True try: while 1: buffer = file.read(16*1024) if not buffer: break parser.Parse(buffer, False) if first_buffer and self.document.documentElement: self._setup_subset(buffer) first_buffer = False parser.Parse(b"", True) except ParseEscape: pass doc = self.document self.reset() self._parser = None return doc def parseString(self, string): """Parse a document from a string, returning the document node.""" parser = self.getParser() try: parser.Parse(string, True) self._setup_subset(string) except ParseEscape: pass doc = self.document self.reset() self._parser = None return doc def _setup_subset(self, buffer): """Load the internal subset if there might be one.""" if self.document.doctype: extractor = InternalSubsetExtractor() extractor.parseString(buffer) subset = extractor.getSubset() self.document.doctype.internalSubset = subset def start_doctype_decl_handler(self, doctypeName, systemId, publicId, has_internal_subset): doctype = self.document.implementation.createDocumentType( doctypeName, publicId, systemId) doctype.ownerDocument = self.document _append_child(self.document, doctype) self.document.doctype = doctype if self._filter and self._filter.acceptNode(doctype) == FILTER_REJECT: self.document.doctype = None del self.document.childNodes[-1] doctype = None self._parser.EntityDeclHandler = None self._parser.NotationDeclHandler = None if has_internal_subset: if doctype is not None: doctype.entities._seq = [] doctype.notations._seq = [] self._parser.CommentHandler = None self._parser.ProcessingInstructionHandler = None self._parser.EndDoctypeDeclHandler = self.end_doctype_decl_handler def end_doctype_decl_handler(self): if self._options.comments: self._parser.CommentHandler = self.comment_handler self._parser.ProcessingInstructionHandler = self.pi_handler if not (self._elem_info or self._filter): self._finish_end_element = id def pi_handler(self, target, data): node = self.document.createProcessingInstruction(target, data) _append_child(self.curNode, node) if self._filter and self._filter.acceptNode(node) == FILTER_REJECT: self.curNode.removeChild(node) def character_data_handler_cdata(self, data): childNodes = self.curNode.childNodes if self._cdata: if ( self._cdata_continue and childNodes[-1].nodeType == CDATA_SECTION_NODE): childNodes[-1].appendData(data) return node = self.document.createCDATASection(data) self._cdata_continue = True elif childNodes and childNodes[-1].nodeType == TEXT_NODE: node = childNodes[-1] value = node.data + data node.data = value return else: node = minidom.Text() node.data = data node.ownerDocument = self.document _append_child(self.curNode, node) def character_data_handler(self, data): childNodes = self.curNode.childNodes if childNodes and childNodes[-1].nodeType == TEXT_NODE: node = childNodes[-1] node.data = node.data + data return node = minidom.Text() node.data = node.data + data node.ownerDocument = self.document _append_child(self.curNode, node) def entity_decl_handler(self, entityName, is_parameter_entity, value, base, systemId, publicId, notationName): if is_parameter_entity: # we don't care about parameter entities for the DOM return if not self._options.entities: return node = self.document._create_entity(entityName, publicId, systemId, notationName) if value is not None: # internal entity # node *should* be readonly, but we'll cheat child = self.document.createTextNode(value) node.childNodes.append(child) self.document.doctype.entities._seq.append(node) if self._filter and self._filter.acceptNode(node) == FILTER_REJECT: del self.document.doctype.entities._seq[-1] def notation_decl_handler(self, notationName, base, systemId, publicId): node = self.document._create_notation(notationName, publicId, systemId) self.document.doctype.notations._seq.append(node) if self._filter and self._filter.acceptNode(node) == FILTER_ACCEPT: del self.document.doctype.notations._seq[-1] def comment_handler(self, data): node = self.document.createComment(data) _append_child(self.curNode, node) if self._filter and self._filter.acceptNode(node) == FILTER_REJECT: self.curNode.removeChild(node) def start_cdata_section_handler(self): self._cdata = True self._cdata_continue = False def end_cdata_section_handler(self): self._cdata = False self._cdata_continue = False def external_entity_ref_handler(self, context, base, systemId, publicId): return 1 def first_element_handler(self, name, attributes): if self._filter is None and not self._elem_info: self._finish_end_element = id self.getParser().StartElementHandler = self.start_element_handler self.start_element_handler(name, attributes) def start_element_handler(self, name, attributes): node = self.document.createElement(name) _append_child(self.curNode, node) self.curNode = node if attributes: for i in range(0, len(attributes), 2): a = minidom.Attr(attributes[i], EMPTY_NAMESPACE, None, EMPTY_PREFIX) value = attributes[i+1] a.value = value a.ownerDocument = self.document _set_attribute_node(node, a) if node is not self.document.documentElement: self._finish_start_element(node) def _finish_start_element(self, node): if self._filter: # To be general, we'd have to call isSameNode(), but this # is sufficient for minidom: if node is self.document.documentElement: return filt = self._filter.startContainer(node) if filt == FILTER_REJECT: # ignore this node & all descendents Rejecter(self) elif filt == FILTER_SKIP: # ignore this node, but make it's children become # children of the parent node Skipper(self) else: return self.curNode = node.parentNode node.parentNode.removeChild(node) node.unlink() # If this ever changes, Namespaces.end_element_handler() needs to # be changed to match. # def end_element_handler(self, name): curNode = self.curNode self.curNode = curNode.parentNode self._finish_end_element(curNode) def _finish_end_element(self, curNode): info = self._elem_info.get(curNode.tagName) if info: self._handle_white_text_nodes(curNode, info) if self._filter: if curNode is self.document.documentElement: return if self._filter.acceptNode(curNode) == FILTER_REJECT: self.curNode.removeChild(curNode) curNode.unlink() def _handle_white_text_nodes(self, node, info): if (self._options.whitespace_in_element_content or not info.isElementContent()): return # We have element type information and should remove ignorable # whitespace; identify for text nodes which contain only # whitespace. L = [] for child in node.childNodes: if child.nodeType == TEXT_NODE and not child.data.strip(): L.append(child) # Remove ignorable whitespace from the tree. for child in L: node.removeChild(child) def element_decl_handler(self, name, model): info = self._elem_info.get(name) if info is None: self._elem_info[name] = ElementInfo(name, model) else: assert info._model is None info._model = model def attlist_decl_handler(self, elem, name, type, default, required): info = self._elem_info.get(elem) if info is None: info = ElementInfo(elem) self._elem_info[elem] = info info._attr_info.append( [None, name, None, None, default, 0, type, required]) def xml_decl_handler(self, version, encoding, standalone): self.document.version = version self.document.encoding = encoding # This is still a little ugly, thanks to the pyexpat API. ;-( if standalone >= 0: if standalone: self.document.standalone = True else: self.document.standalone = False # Don't include FILTER_INTERRUPT, since that's checked separately # where allowed. _ALLOWED_FILTER_RETURNS = (FILTER_ACCEPT, FILTER_REJECT, FILTER_SKIP) class FilterVisibilityController(object): """Wrapper around a DOMBuilderFilter which implements the checks to make the whatToShow filter attribute work.""" __slots__ = 'filter', def __init__(self, filter): self.filter = filter def startContainer(self, node): mask = self._nodetype_mask[node.nodeType] if self.filter.whatToShow & mask: val = self.filter.startContainer(node) if val == FILTER_INTERRUPT: raise ParseEscape if val not in _ALLOWED_FILTER_RETURNS: raise ValueError( "startContainer() returned illegal value: " + repr(val)) return val else: return FILTER_ACCEPT def acceptNode(self, node): mask = self._nodetype_mask[node.nodeType] if self.filter.whatToShow & mask: val = self.filter.acceptNode(node) if val == FILTER_INTERRUPT: raise ParseEscape if val == FILTER_SKIP: # move all child nodes to the parent, and remove this node parent = node.parentNode for child in node.childNodes[:]: parent.appendChild(child) # node is handled by the caller return FILTER_REJECT if val not in _ALLOWED_FILTER_RETURNS: raise ValueError( "acceptNode() returned illegal value: " + repr(val)) return val else: return FILTER_ACCEPT _nodetype_mask = { Node.ELEMENT_NODE: NodeFilter.SHOW_ELEMENT, Node.ATTRIBUTE_NODE: NodeFilter.SHOW_ATTRIBUTE, Node.TEXT_NODE: NodeFilter.SHOW_TEXT, Node.CDATA_SECTION_NODE: NodeFilter.SHOW_CDATA_SECTION, Node.ENTITY_REFERENCE_NODE: NodeFilter.SHOW_ENTITY_REFERENCE, Node.ENTITY_NODE: NodeFilter.SHOW_ENTITY, Node.PROCESSING_INSTRUCTION_NODE: NodeFilter.SHOW_PROCESSING_INSTRUCTION, Node.COMMENT_NODE: NodeFilter.SHOW_COMMENT, Node.DOCUMENT_NODE: NodeFilter.SHOW_DOCUMENT, Node.DOCUMENT_TYPE_NODE: NodeFilter.SHOW_DOCUMENT_TYPE, Node.DOCUMENT_FRAGMENT_NODE: NodeFilter.SHOW_DOCUMENT_FRAGMENT, Node.NOTATION_NODE: NodeFilter.SHOW_NOTATION, } class FilterCrutch(object): __slots__ = '_builder', '_level', '_old_start', '_old_end' def __init__(self, builder): self._level = 0 self._builder = builder parser = builder._parser self._old_start = parser.StartElementHandler self._old_end = parser.EndElementHandler parser.StartElementHandler = self.start_element_handler parser.EndElementHandler = self.end_element_handler class Rejecter(FilterCrutch): __slots__ = () def __init__(self, builder): FilterCrutch.__init__(self, builder) parser = builder._parser for name in ("ProcessingInstructionHandler", "CommentHandler", "CharacterDataHandler", "StartCdataSectionHandler", "EndCdataSectionHandler", "ExternalEntityRefHandler", ): setattr(parser, name, None) def start_element_handler(self, *args): self._level = self._level + 1 def end_element_handler(self, *args): if self._level == 0: # restore the old handlers parser = self._builder._parser self._builder.install(parser) parser.StartElementHandler = self._old_start parser.EndElementHandler = self._old_end else: self._level = self._level - 1 class Skipper(FilterCrutch): __slots__ = () def start_element_handler(self, *args): node = self._builder.curNode self._old_start(*args) if self._builder.curNode is not node: self._level = self._level + 1 def end_element_handler(self, *args): if self._level == 0: # We're popping back out of the node we're skipping, so we # shouldn't need to do anything but reset the handlers. self._builder._parser.StartElementHandler = self._old_start self._builder._parser.EndElementHandler = self._old_end self._builder = None else: self._level = self._level - 1 self._old_end(*args) # framework document used by the fragment builder. # Takes a string for the doctype, subset string, and namespace attrs string. _FRAGMENT_BUILDER_INTERNAL_SYSTEM_ID = \ "http://xml.python.org/entities/fragment-builder/internal" _FRAGMENT_BUILDER_TEMPLATE = ( '''\ %%s ]> &fragment-builder-internal;''' % _FRAGMENT_BUILDER_INTERNAL_SYSTEM_ID) class FragmentBuilder(ExpatBuilder): """Builder which constructs document fragments given XML source text and a context node. The context node is expected to provide information about the namespace declarations which are in scope at the start of the fragment. """ def __init__(self, context, options=None): if context.nodeType == DOCUMENT_NODE: self.originalDocument = context self.context = context else: self.originalDocument = context.ownerDocument self.context = context ExpatBuilder.__init__(self, options) def reset(self): ExpatBuilder.reset(self) self.fragment = None def parseFile(self, file): """Parse a document fragment from a file object, returning the fragment node.""" return self.parseString(file.read()) def parseString(self, string): """Parse a document fragment from a string, returning the fragment node.""" self._source = string parser = self.getParser() doctype = self.originalDocument.doctype ident = "" if doctype: subset = doctype.internalSubset or self._getDeclarations() if doctype.publicId: ident = ('PUBLIC "%s" "%s"' % (doctype.publicId, doctype.systemId)) elif doctype.systemId: ident = 'SYSTEM "%s"' % doctype.systemId else: subset = "" nsattrs = self._getNSattrs() # get ns decls from node's ancestors document = _FRAGMENT_BUILDER_TEMPLATE % (ident, subset, nsattrs) try: parser.Parse(document, True) except: self.reset() raise fragment = self.fragment self.reset() ## self._parser = None return fragment def _getDeclarations(self): """Re-create the internal subset from the DocumentType node. This is only needed if we don't already have the internalSubset as a string. """ doctype = self.context.ownerDocument.doctype s = "" if doctype: for i in range(doctype.notations.length): notation = doctype.notations.item(i) if s: s = s + "\n " s = "%s' \ % (s, notation.publicId, notation.systemId) else: s = '%s SYSTEM "%s">' % (s, notation.systemId) for i in range(doctype.entities.length): entity = doctype.entities.item(i) if s: s = s + "\n " s = "%s" return s def _getNSattrs(self): return "" def external_entity_ref_handler(self, context, base, systemId, publicId): if systemId == _FRAGMENT_BUILDER_INTERNAL_SYSTEM_ID: # this entref is the one that we made to put the subtree # in; all of our given input is parsed in here. old_document = self.document old_cur_node = self.curNode parser = self._parser.ExternalEntityParserCreate(context) # put the real document back, parse into the fragment to return self.document = self.originalDocument self.fragment = self.document.createDocumentFragment() self.curNode = self.fragment try: parser.Parse(self._source, True) finally: self.curNode = old_cur_node self.document = old_document self._source = None return -1 else: return ExpatBuilder.external_entity_ref_handler( self, context, base, systemId, publicId) class Namespaces: """Mix-in class for builders; adds support for namespaces.""" def _initNamespaces(self): # list of (prefix, uri) ns declarations. Namespace attrs are # constructed from this and added to the element's attrs. self._ns_ordered_prefixes = [] def createParser(self): """Create a new namespace-handling parser.""" parser = expat.ParserCreate(namespace_separator=" ") parser.namespace_prefixes = True return parser def install(self, parser): """Insert the namespace-handlers onto the parser.""" ExpatBuilder.install(self, parser) if self._options.namespace_declarations: parser.StartNamespaceDeclHandler = ( self.start_namespace_decl_handler) def start_namespace_decl_handler(self, prefix, uri): """Push this namespace declaration on our storage.""" self._ns_ordered_prefixes.append((prefix, uri)) def start_element_handler(self, name, attributes): if ' ' in name: uri, localname, prefix, qname = _parse_ns_name(self, name) else: uri = EMPTY_NAMESPACE qname = name localname = None prefix = EMPTY_PREFIX node = minidom.Element(qname, uri, prefix, localname) node.ownerDocument = self.document _append_child(self.curNode, node) self.curNode = node if self._ns_ordered_prefixes: for prefix, uri in self._ns_ordered_prefixes: if prefix: a = minidom.Attr(_intern(self, 'xmlns:' + prefix), XMLNS_NAMESPACE, prefix, "xmlns") else: a = minidom.Attr("xmlns", XMLNS_NAMESPACE, "xmlns", EMPTY_PREFIX) a.value = uri a.ownerDocument = self.document _set_attribute_node(node, a) del self._ns_ordered_prefixes[:] if attributes: node._ensure_attributes() _attrs = node._attrs _attrsNS = node._attrsNS for i in range(0, len(attributes), 2): aname = attributes[i] value = attributes[i+1] if ' ' in aname: uri, localname, prefix, qname = _parse_ns_name(self, aname) a = minidom.Attr(qname, uri, localname, prefix) _attrs[qname] = a _attrsNS[(uri, localname)] = a else: a = minidom.Attr(aname, EMPTY_NAMESPACE, aname, EMPTY_PREFIX) _attrs[aname] = a _attrsNS[(EMPTY_NAMESPACE, aname)] = a a.ownerDocument = self.document a.value = value a.ownerElement = node if __debug__: # This only adds some asserts to the original # end_element_handler(), so we only define this when -O is not # used. If changing one, be sure to check the other to see if # it needs to be changed as well. # def end_element_handler(self, name): curNode = self.curNode if ' ' in name: uri, localname, prefix, qname = _parse_ns_name(self, name) assert (curNode.namespaceURI == uri and curNode.localName == localname and curNode.prefix == prefix), \ "element stack messed up! (namespace)" else: assert curNode.nodeName == name, \ "element stack messed up - bad nodeName" assert curNode.namespaceURI == EMPTY_NAMESPACE, \ "element stack messed up - bad namespaceURI" self.curNode = curNode.parentNode self._finish_end_element(curNode) class ExpatBuilderNS(Namespaces, ExpatBuilder): """Document builder that supports namespaces.""" def reset(self): ExpatBuilder.reset(self) self._initNamespaces() class FragmentBuilderNS(Namespaces, FragmentBuilder): """Fragment builder that supports namespaces.""" def reset(self): FragmentBuilder.reset(self) self._initNamespaces() def _getNSattrs(self): """Return string of namespace attributes from this element and ancestors.""" # XXX This needs to be re-written to walk the ancestors of the # context to build up the namespace information from # declarations, elements, and attributes found in context. # Otherwise we have to store a bunch more data on the DOM # (though that *might* be more reliable -- not clear). attrs = "" context = self.context L = [] while context: if hasattr(context, '_ns_prefix_uri'): for prefix, uri in context._ns_prefix_uri.items(): # add every new NS decl from context to L and attrs string if prefix in L: continue L.append(prefix) if prefix: declname = "xmlns:" + prefix else: declname = "xmlns" if attrs: attrs = "%s\n %s='%s'" % (attrs, declname, uri) else: attrs = " %s='%s'" % (declname, uri) context = context.parentNode return attrs class ParseEscape(Exception): """Exception raised to short-circuit parsing in InternalSubsetExtractor.""" pass class InternalSubsetExtractor(ExpatBuilder): """XML processor which can rip out the internal document type subset.""" subset = None def getSubset(self): """Return the internal subset as a string.""" return self.subset def parseFile(self, file): try: ExpatBuilder.parseFile(self, file) except ParseEscape: pass def parseString(self, string): try: ExpatBuilder.parseString(self, string) except ParseEscape: pass def install(self, parser): parser.StartDoctypeDeclHandler = self.start_doctype_decl_handler parser.StartElementHandler = self.start_element_handler def start_doctype_decl_handler(self, name, publicId, systemId, has_internal_subset): if has_internal_subset: parser = self.getParser() self.subset = [] parser.DefaultHandler = self.subset.append parser.EndDoctypeDeclHandler = self.end_doctype_decl_handler else: raise ParseEscape() def end_doctype_decl_handler(self): s = ''.join(self.subset).replace('\r\n', '\n').replace('\r', '\n') self.subset = s raise ParseEscape() def start_element_handler(self, name, attrs): raise ParseEscape() def parse(file, namespaces=True): """Parse a document, returning the resulting Document node. 'file' may be either a file name or an open file object. """ if namespaces: builder = ExpatBuilderNS() else: builder = ExpatBuilder() if isinstance(file, str): with open(file, 'rb') as fp: result = builder.parseFile(fp) else: result = builder.parseFile(file) return result def parseString(string, namespaces=True): """Parse a document from a string, returning the resulting Document node. """ if namespaces: builder = ExpatBuilderNS() else: builder = ExpatBuilder() return builder.parseString(string) def parseFragment(file, context, namespaces=True): """Parse a fragment of a document, given the context from which it was originally extracted. context should be the parent of the node(s) which are in the fragment. 'file' may be either a file name or an open file object. """ if namespaces: builder = FragmentBuilderNS(context) else: builder = FragmentBuilder(context) if isinstance(file, str): with open(file, 'rb') as fp: result = builder.parseFile(fp) else: result = builder.parseFile(file) return result def parseFragmentString(string, context, namespaces=True): """Parse a fragment of a document from a string, given the context from which it was originally extracted. context should be the parent of the node(s) which are in the fragment. """ if namespaces: builder = FragmentBuilderNS(context) else: builder = FragmentBuilder(context) return builder.parseString(string) def makeBuilder(options): """Create a builder based on an Options object.""" if options.namespaces: return ExpatBuilderNS(options) else: return ExpatBuilder(options) PKN\oF, , dom/minidom.pynu["""Simple implementation of the Level 1 DOM. Namespaces and other minor Level 2 features are also supported. parse("foo.xml") parseString("") Todo: ===== * convenience methods for getting elements and text. * more testing * bring some of the writer and linearizer code into conformance with this interface * SAX 2 namespaces """ import io import xml.dom from xml.dom import EMPTY_NAMESPACE, EMPTY_PREFIX, XMLNS_NAMESPACE, domreg from xml.dom.minicompat import * from xml.dom.xmlbuilder import DOMImplementationLS, DocumentLS # This is used by the ID-cache invalidation checks; the list isn't # actually complete, since the nodes being checked will never be the # DOCUMENT_NODE or DOCUMENT_FRAGMENT_NODE. (The node being checked is # the node being added or removed, not the node being modified.) # _nodeTypes_with_children = (xml.dom.Node.ELEMENT_NODE, xml.dom.Node.ENTITY_REFERENCE_NODE) class Node(xml.dom.Node): namespaceURI = None # this is non-null only for elements and attributes parentNode = None ownerDocument = None nextSibling = None previousSibling = None prefix = EMPTY_PREFIX # non-null only for NS elements and attributes def __bool__(self): return True def toxml(self, encoding=None, standalone=None): return self.toprettyxml("", "", encoding, standalone) def toprettyxml(self, indent="\t", newl="\n", encoding=None, standalone=None): if encoding is None: writer = io.StringIO() else: writer = io.TextIOWrapper(io.BytesIO(), encoding=encoding, errors="xmlcharrefreplace", newline='\n') if self.nodeType == Node.DOCUMENT_NODE: # Can pass encoding only to document, to put it into XML header self.writexml(writer, "", indent, newl, encoding, standalone) else: self.writexml(writer, "", indent, newl) if encoding is None: return writer.getvalue() else: return writer.detach().getvalue() def hasChildNodes(self): return bool(self.childNodes) def _get_childNodes(self): return self.childNodes def _get_firstChild(self): if self.childNodes: return self.childNodes[0] def _get_lastChild(self): if self.childNodes: return self.childNodes[-1] def insertBefore(self, newChild, refChild): if newChild.nodeType == self.DOCUMENT_FRAGMENT_NODE: for c in tuple(newChild.childNodes): self.insertBefore(c, refChild) ### The DOM does not clearly specify what to return in this case return newChild if newChild.nodeType not in self._child_node_types: raise xml.dom.HierarchyRequestErr( "%s cannot be child of %s" % (repr(newChild), repr(self))) if newChild.parentNode is not None: newChild.parentNode.removeChild(newChild) if refChild is None: self.appendChild(newChild) else: try: index = self.childNodes.index(refChild) except ValueError: raise xml.dom.NotFoundErr() if newChild.nodeType in _nodeTypes_with_children: _clear_id_cache(self) self.childNodes.insert(index, newChild) newChild.nextSibling = refChild refChild.previousSibling = newChild if index: node = self.childNodes[index-1] node.nextSibling = newChild newChild.previousSibling = node else: newChild.previousSibling = None newChild.parentNode = self return newChild def appendChild(self, node): if node.nodeType == self.DOCUMENT_FRAGMENT_NODE: for c in tuple(node.childNodes): self.appendChild(c) ### The DOM does not clearly specify what to return in this case return node if node.nodeType not in self._child_node_types: raise xml.dom.HierarchyRequestErr( "%s cannot be child of %s" % (repr(node), repr(self))) elif node.nodeType in _nodeTypes_with_children: _clear_id_cache(self) if node.parentNode is not None: node.parentNode.removeChild(node) _append_child(self, node) node.nextSibling = None return node def replaceChild(self, newChild, oldChild): if newChild.nodeType == self.DOCUMENT_FRAGMENT_NODE: refChild = oldChild.nextSibling self.removeChild(oldChild) return self.insertBefore(newChild, refChild) if newChild.nodeType not in self._child_node_types: raise xml.dom.HierarchyRequestErr( "%s cannot be child of %s" % (repr(newChild), repr(self))) if newChild is oldChild: return if newChild.parentNode is not None: newChild.parentNode.removeChild(newChild) try: index = self.childNodes.index(oldChild) except ValueError: raise xml.dom.NotFoundErr() self.childNodes[index] = newChild newChild.parentNode = self oldChild.parentNode = None if (newChild.nodeType in _nodeTypes_with_children or oldChild.nodeType in _nodeTypes_with_children): _clear_id_cache(self) newChild.nextSibling = oldChild.nextSibling newChild.previousSibling = oldChild.previousSibling oldChild.nextSibling = None oldChild.previousSibling = None if newChild.previousSibling: newChild.previousSibling.nextSibling = newChild if newChild.nextSibling: newChild.nextSibling.previousSibling = newChild return oldChild def removeChild(self, oldChild): try: self.childNodes.remove(oldChild) except ValueError: raise xml.dom.NotFoundErr() if oldChild.nextSibling is not None: oldChild.nextSibling.previousSibling = oldChild.previousSibling if oldChild.previousSibling is not None: oldChild.previousSibling.nextSibling = oldChild.nextSibling oldChild.nextSibling = oldChild.previousSibling = None if oldChild.nodeType in _nodeTypes_with_children: _clear_id_cache(self) oldChild.parentNode = None return oldChild def normalize(self): L = [] for child in self.childNodes: if child.nodeType == Node.TEXT_NODE: if not child.data: # empty text node; discard if L: L[-1].nextSibling = child.nextSibling if child.nextSibling: child.nextSibling.previousSibling = child.previousSibling child.unlink() elif L and L[-1].nodeType == child.nodeType: # collapse text node node = L[-1] node.data = node.data + child.data node.nextSibling = child.nextSibling if child.nextSibling: child.nextSibling.previousSibling = node child.unlink() else: L.append(child) else: L.append(child) if child.nodeType == Node.ELEMENT_NODE: child.normalize() self.childNodes[:] = L def cloneNode(self, deep): return _clone_node(self, deep, self.ownerDocument or self) def isSupported(self, feature, version): return self.ownerDocument.implementation.hasFeature(feature, version) def _get_localName(self): # Overridden in Element and Attr where localName can be Non-Null return None # Node interfaces from Level 3 (WD 9 April 2002) def isSameNode(self, other): return self is other def getInterface(self, feature): if self.isSupported(feature, None): return self else: return None # The "user data" functions use a dictionary that is only present # if some user data has been set, so be careful not to assume it # exists. def getUserData(self, key): try: return self._user_data[key][0] except (AttributeError, KeyError): return None def setUserData(self, key, data, handler): old = None try: d = self._user_data except AttributeError: d = {} self._user_data = d if key in d: old = d[key][0] if data is None: # ignore handlers passed for None handler = None if old is not None: del d[key] else: d[key] = (data, handler) return old def _call_user_data_handler(self, operation, src, dst): if hasattr(self, "_user_data"): for key, (data, handler) in list(self._user_data.items()): if handler is not None: handler.handle(operation, key, data, src, dst) # minidom-specific API: def unlink(self): self.parentNode = self.ownerDocument = None if self.childNodes: for child in self.childNodes: child.unlink() self.childNodes = NodeList() self.previousSibling = None self.nextSibling = None # A Node is its own context manager, to ensure that an unlink() call occurs. # This is similar to how a file object works. def __enter__(self): return self def __exit__(self, et, ev, tb): self.unlink() defproperty(Node, "firstChild", doc="First child node, or None.") defproperty(Node, "lastChild", doc="Last child node, or None.") defproperty(Node, "localName", doc="Namespace-local name of this node.") def _append_child(self, node): # fast path with less checks; usable by DOM builders if careful childNodes = self.childNodes if childNodes: last = childNodes[-1] node.previousSibling = last last.nextSibling = node childNodes.append(node) node.parentNode = self def _in_document(node): # return True iff node is part of a document tree while node is not None: if node.nodeType == Node.DOCUMENT_NODE: return True node = node.parentNode return False def _write_data(writer, data): "Writes datachars to writer." if data: data = data.replace("&", "&").replace("<", "<"). \ replace("\"", """).replace(">", ">") writer.write(data) def _get_elements_by_tagName_helper(parent, name, rc): for node in parent.childNodes: if node.nodeType == Node.ELEMENT_NODE and \ (name == "*" or node.tagName == name): rc.append(node) _get_elements_by_tagName_helper(node, name, rc) return rc def _get_elements_by_tagName_ns_helper(parent, nsURI, localName, rc): for node in parent.childNodes: if node.nodeType == Node.ELEMENT_NODE: if ((localName == "*" or node.localName == localName) and (nsURI == "*" or node.namespaceURI == nsURI)): rc.append(node) _get_elements_by_tagName_ns_helper(node, nsURI, localName, rc) return rc class DocumentFragment(Node): nodeType = Node.DOCUMENT_FRAGMENT_NODE nodeName = "#document-fragment" nodeValue = None attributes = None parentNode = None _child_node_types = (Node.ELEMENT_NODE, Node.TEXT_NODE, Node.CDATA_SECTION_NODE, Node.ENTITY_REFERENCE_NODE, Node.PROCESSING_INSTRUCTION_NODE, Node.COMMENT_NODE, Node.NOTATION_NODE) def __init__(self): self.childNodes = NodeList() class Attr(Node): __slots__=('_name', '_value', 'namespaceURI', '_prefix', 'childNodes', '_localName', 'ownerDocument', 'ownerElement') nodeType = Node.ATTRIBUTE_NODE attributes = None specified = False _is_id = False _child_node_types = (Node.TEXT_NODE, Node.ENTITY_REFERENCE_NODE) def __init__(self, qName, namespaceURI=EMPTY_NAMESPACE, localName=None, prefix=None): self.ownerElement = None self._name = qName self.namespaceURI = namespaceURI self._prefix = prefix if localName is not None: self._localName = localName self.childNodes = NodeList() # Add the single child node that represents the value of the attr self.childNodes.append(Text()) # nodeValue and value are set elsewhere def _get_localName(self): try: return self._localName except AttributeError: return self.nodeName.split(":", 1)[-1] def _get_specified(self): return self.specified def _get_name(self): return self._name def _set_name(self, value): self._name = value if self.ownerElement is not None: _clear_id_cache(self.ownerElement) nodeName = name = property(_get_name, _set_name) def _get_value(self): return self._value def _set_value(self, value): self._value = value self.childNodes[0].data = value if self.ownerElement is not None: _clear_id_cache(self.ownerElement) self.childNodes[0].data = value nodeValue = value = property(_get_value, _set_value) def _get_prefix(self): return self._prefix def _set_prefix(self, prefix): nsuri = self.namespaceURI if prefix == "xmlns": if nsuri and nsuri != XMLNS_NAMESPACE: raise xml.dom.NamespaceErr( "illegal use of 'xmlns' prefix for the wrong namespace") self._prefix = prefix if prefix is None: newName = self.localName else: newName = "%s:%s" % (prefix, self.localName) if self.ownerElement: _clear_id_cache(self.ownerElement) self.name = newName prefix = property(_get_prefix, _set_prefix) def unlink(self): # This implementation does not call the base implementation # since most of that is not needed, and the expense of the # method call is not warranted. We duplicate the removal of # children, but that's all we needed from the base class. elem = self.ownerElement if elem is not None: del elem._attrs[self.nodeName] del elem._attrsNS[(self.namespaceURI, self.localName)] if self._is_id: self._is_id = False elem._magic_id_nodes -= 1 self.ownerDocument._magic_id_count -= 1 for child in self.childNodes: child.unlink() del self.childNodes[:] def _get_isId(self): if self._is_id: return True doc = self.ownerDocument elem = self.ownerElement if doc is None or elem is None: return False info = doc._get_elem_info(elem) if info is None: return False if self.namespaceURI: return info.isIdNS(self.namespaceURI, self.localName) else: return info.isId(self.nodeName) def _get_schemaType(self): doc = self.ownerDocument elem = self.ownerElement if doc is None or elem is None: return _no_type info = doc._get_elem_info(elem) if info is None: return _no_type if self.namespaceURI: return info.getAttributeTypeNS(self.namespaceURI, self.localName) else: return info.getAttributeType(self.nodeName) defproperty(Attr, "isId", doc="True if this attribute is an ID.") defproperty(Attr, "localName", doc="Namespace-local name of this attribute.") defproperty(Attr, "schemaType", doc="Schema type for this attribute.") class NamedNodeMap(object): """The attribute list is a transient interface to the underlying dictionaries. Mutations here will change the underlying element's dictionary. Ordering is imposed artificially and does not reflect the order of attributes as found in an input document. """ __slots__ = ('_attrs', '_attrsNS', '_ownerElement') def __init__(self, attrs, attrsNS, ownerElement): self._attrs = attrs self._attrsNS = attrsNS self._ownerElement = ownerElement def _get_length(self): return len(self._attrs) def item(self, index): try: return self[list(self._attrs.keys())[index]] except IndexError: return None def items(self): L = [] for node in self._attrs.values(): L.append((node.nodeName, node.value)) return L def itemsNS(self): L = [] for node in self._attrs.values(): L.append(((node.namespaceURI, node.localName), node.value)) return L def __contains__(self, key): if isinstance(key, str): return key in self._attrs else: return key in self._attrsNS def keys(self): return self._attrs.keys() def keysNS(self): return self._attrsNS.keys() def values(self): return self._attrs.values() def get(self, name, value=None): return self._attrs.get(name, value) __len__ = _get_length def _cmp(self, other): if self._attrs is getattr(other, "_attrs", None): return 0 else: return (id(self) > id(other)) - (id(self) < id(other)) def __eq__(self, other): return self._cmp(other) == 0 def __ge__(self, other): return self._cmp(other) >= 0 def __gt__(self, other): return self._cmp(other) > 0 def __le__(self, other): return self._cmp(other) <= 0 def __lt__(self, other): return self._cmp(other) < 0 def __getitem__(self, attname_or_tuple): if isinstance(attname_or_tuple, tuple): return self._attrsNS[attname_or_tuple] else: return self._attrs[attname_or_tuple] # same as set def __setitem__(self, attname, value): if isinstance(value, str): try: node = self._attrs[attname] except KeyError: node = Attr(attname) node.ownerDocument = self._ownerElement.ownerDocument self.setNamedItem(node) node.value = value else: if not isinstance(value, Attr): raise TypeError("value must be a string or Attr object") node = value self.setNamedItem(node) def getNamedItem(self, name): try: return self._attrs[name] except KeyError: return None def getNamedItemNS(self, namespaceURI, localName): try: return self._attrsNS[(namespaceURI, localName)] except KeyError: return None def removeNamedItem(self, name): n = self.getNamedItem(name) if n is not None: _clear_id_cache(self._ownerElement) del self._attrs[n.nodeName] del self._attrsNS[(n.namespaceURI, n.localName)] if hasattr(n, 'ownerElement'): n.ownerElement = None return n else: raise xml.dom.NotFoundErr() def removeNamedItemNS(self, namespaceURI, localName): n = self.getNamedItemNS(namespaceURI, localName) if n is not None: _clear_id_cache(self._ownerElement) del self._attrsNS[(n.namespaceURI, n.localName)] del self._attrs[n.nodeName] if hasattr(n, 'ownerElement'): n.ownerElement = None return n else: raise xml.dom.NotFoundErr() def setNamedItem(self, node): if not isinstance(node, Attr): raise xml.dom.HierarchyRequestErr( "%s cannot be child of %s" % (repr(node), repr(self))) old = self._attrs.get(node.name) if old: old.unlink() self._attrs[node.name] = node self._attrsNS[(node.namespaceURI, node.localName)] = node node.ownerElement = self._ownerElement _clear_id_cache(node.ownerElement) return old def setNamedItemNS(self, node): return self.setNamedItem(node) def __delitem__(self, attname_or_tuple): node = self[attname_or_tuple] _clear_id_cache(node.ownerElement) node.unlink() def __getstate__(self): return self._attrs, self._attrsNS, self._ownerElement def __setstate__(self, state): self._attrs, self._attrsNS, self._ownerElement = state defproperty(NamedNodeMap, "length", doc="Number of nodes in the NamedNodeMap.") AttributeList = NamedNodeMap class TypeInfo(object): __slots__ = 'namespace', 'name' def __init__(self, namespace, name): self.namespace = namespace self.name = name def __repr__(self): if self.namespace: return "<%s %r (from %r)>" % (self.__class__.__name__, self.name, self.namespace) else: return "<%s %r>" % (self.__class__.__name__, self.name) def _get_name(self): return self.name def _get_namespace(self): return self.namespace _no_type = TypeInfo(None, None) class Element(Node): __slots__=('ownerDocument', 'parentNode', 'tagName', 'nodeName', 'prefix', 'namespaceURI', '_localName', 'childNodes', '_attrs', '_attrsNS', 'nextSibling', 'previousSibling') nodeType = Node.ELEMENT_NODE nodeValue = None schemaType = _no_type _magic_id_nodes = 0 _child_node_types = (Node.ELEMENT_NODE, Node.PROCESSING_INSTRUCTION_NODE, Node.COMMENT_NODE, Node.TEXT_NODE, Node.CDATA_SECTION_NODE, Node.ENTITY_REFERENCE_NODE) def __init__(self, tagName, namespaceURI=EMPTY_NAMESPACE, prefix=None, localName=None): self.parentNode = None self.tagName = self.nodeName = tagName self.prefix = prefix self.namespaceURI = namespaceURI self.childNodes = NodeList() self.nextSibling = self.previousSibling = None # Attribute dictionaries are lazily created # attributes are double-indexed: # tagName -> Attribute # URI,localName -> Attribute # in the future: consider lazy generation # of attribute objects this is too tricky # for now because of headaches with # namespaces. self._attrs = None self._attrsNS = None def _ensure_attributes(self): if self._attrs is None: self._attrs = {} self._attrsNS = {} def _get_localName(self): try: return self._localName except AttributeError: return self.tagName.split(":", 1)[-1] def _get_tagName(self): return self.tagName def unlink(self): if self._attrs is not None: for attr in list(self._attrs.values()): attr.unlink() self._attrs = None self._attrsNS = None Node.unlink(self) def getAttribute(self, attname): """Returns the value of the specified attribute. Returns the value of the element's attribute named attname as a string. An empty string is returned if the element does not have such an attribute. Note that an empty string may also be returned as an explicitly given attribute value, use the hasAttribute method to distinguish these two cases. """ if self._attrs is None: return "" try: return self._attrs[attname].value except KeyError: return "" def getAttributeNS(self, namespaceURI, localName): if self._attrsNS is None: return "" try: return self._attrsNS[(namespaceURI, localName)].value except KeyError: return "" def setAttribute(self, attname, value): attr = self.getAttributeNode(attname) if attr is None: attr = Attr(attname) attr.value = value # also sets nodeValue attr.ownerDocument = self.ownerDocument self.setAttributeNode(attr) elif value != attr.value: attr.value = value if attr.isId: _clear_id_cache(self) def setAttributeNS(self, namespaceURI, qualifiedName, value): prefix, localname = _nssplit(qualifiedName) attr = self.getAttributeNodeNS(namespaceURI, localname) if attr is None: attr = Attr(qualifiedName, namespaceURI, localname, prefix) attr.value = value attr.ownerDocument = self.ownerDocument self.setAttributeNode(attr) else: if value != attr.value: attr.value = value if attr.isId: _clear_id_cache(self) if attr.prefix != prefix: attr.prefix = prefix attr.nodeName = qualifiedName def getAttributeNode(self, attrname): if self._attrs is None: return None return self._attrs.get(attrname) def getAttributeNodeNS(self, namespaceURI, localName): if self._attrsNS is None: return None return self._attrsNS.get((namespaceURI, localName)) def setAttributeNode(self, attr): if attr.ownerElement not in (None, self): raise xml.dom.InuseAttributeErr("attribute node already owned") self._ensure_attributes() old1 = self._attrs.get(attr.name, None) if old1 is not None: self.removeAttributeNode(old1) old2 = self._attrsNS.get((attr.namespaceURI, attr.localName), None) if old2 is not None and old2 is not old1: self.removeAttributeNode(old2) _set_attribute_node(self, attr) if old1 is not attr: # It might have already been part of this node, in which case # it doesn't represent a change, and should not be returned. return old1 if old2 is not attr: return old2 setAttributeNodeNS = setAttributeNode def removeAttribute(self, name): if self._attrsNS is None: raise xml.dom.NotFoundErr() try: attr = self._attrs[name] except KeyError: raise xml.dom.NotFoundErr() self.removeAttributeNode(attr) def removeAttributeNS(self, namespaceURI, localName): if self._attrsNS is None: raise xml.dom.NotFoundErr() try: attr = self._attrsNS[(namespaceURI, localName)] except KeyError: raise xml.dom.NotFoundErr() self.removeAttributeNode(attr) def removeAttributeNode(self, node): if node is None: raise xml.dom.NotFoundErr() try: self._attrs[node.name] except KeyError: raise xml.dom.NotFoundErr() _clear_id_cache(self) node.unlink() # Restore this since the node is still useful and otherwise # unlinked node.ownerDocument = self.ownerDocument return node removeAttributeNodeNS = removeAttributeNode def hasAttribute(self, name): """Checks whether the element has an attribute with the specified name. Returns True if the element has an attribute with the specified name. Otherwise, returns False. """ if self._attrs is None: return False return name in self._attrs def hasAttributeNS(self, namespaceURI, localName): if self._attrsNS is None: return False return (namespaceURI, localName) in self._attrsNS def getElementsByTagName(self, name): """Returns all descendant elements with the given tag name. Returns the list of all descendant elements (not direct children only) with the specified tag name. """ return _get_elements_by_tagName_helper(self, name, NodeList()) def getElementsByTagNameNS(self, namespaceURI, localName): return _get_elements_by_tagName_ns_helper( self, namespaceURI, localName, NodeList()) def __repr__(self): return "" % (self.tagName, id(self)) def writexml(self, writer, indent="", addindent="", newl=""): """Write an XML element to a file-like object Write the element to the writer object that must provide a write method (e.g. a file or StringIO object). """ # indent = current indentation # addindent = indentation to add to higher levels # newl = newline string writer.write(indent+"<" + self.tagName) attrs = self._get_attributes() for a_name in attrs.keys(): writer.write(" %s=\"" % a_name) _write_data(writer, attrs[a_name].value) writer.write("\"") if self.childNodes: writer.write(">") if (len(self.childNodes) == 1 and self.childNodes[0].nodeType in ( Node.TEXT_NODE, Node.CDATA_SECTION_NODE)): self.childNodes[0].writexml(writer, '', '', '') else: writer.write(newl) for node in self.childNodes: node.writexml(writer, indent+addindent, addindent, newl) writer.write(indent) writer.write("%s" % (self.tagName, newl)) else: writer.write("/>%s"%(newl)) def _get_attributes(self): self._ensure_attributes() return NamedNodeMap(self._attrs, self._attrsNS, self) def hasAttributes(self): if self._attrs: return True else: return False # DOM Level 3 attributes, based on the 22 Oct 2002 draft def setIdAttribute(self, name): idAttr = self.getAttributeNode(name) self.setIdAttributeNode(idAttr) def setIdAttributeNS(self, namespaceURI, localName): idAttr = self.getAttributeNodeNS(namespaceURI, localName) self.setIdAttributeNode(idAttr) def setIdAttributeNode(self, idAttr): if idAttr is None or not self.isSameNode(idAttr.ownerElement): raise xml.dom.NotFoundErr() if _get_containing_entref(self) is not None: raise xml.dom.NoModificationAllowedErr() if not idAttr._is_id: idAttr._is_id = True self._magic_id_nodes += 1 self.ownerDocument._magic_id_count += 1 _clear_id_cache(self) defproperty(Element, "attributes", doc="NamedNodeMap of attributes on the element.") defproperty(Element, "localName", doc="Namespace-local name of this element.") def _set_attribute_node(element, attr): _clear_id_cache(element) element._ensure_attributes() element._attrs[attr.name] = attr element._attrsNS[(attr.namespaceURI, attr.localName)] = attr # This creates a circular reference, but Element.unlink() # breaks the cycle since the references to the attribute # dictionaries are tossed. attr.ownerElement = element class Childless: """Mixin that makes childless-ness easy to implement and avoids the complexity of the Node methods that deal with children. """ __slots__ = () attributes = None childNodes = EmptyNodeList() firstChild = None lastChild = None def _get_firstChild(self): return None def _get_lastChild(self): return None def appendChild(self, node): raise xml.dom.HierarchyRequestErr( self.nodeName + " nodes cannot have children") def hasChildNodes(self): return False def insertBefore(self, newChild, refChild): raise xml.dom.HierarchyRequestErr( self.nodeName + " nodes do not have children") def removeChild(self, oldChild): raise xml.dom.NotFoundErr( self.nodeName + " nodes do not have children") def normalize(self): # For childless nodes, normalize() has nothing to do. pass def replaceChild(self, newChild, oldChild): raise xml.dom.HierarchyRequestErr( self.nodeName + " nodes do not have children") class ProcessingInstruction(Childless, Node): nodeType = Node.PROCESSING_INSTRUCTION_NODE __slots__ = ('target', 'data') def __init__(self, target, data): self.target = target self.data = data # nodeValue is an alias for data def _get_nodeValue(self): return self.data def _set_nodeValue(self, value): self.data = value nodeValue = property(_get_nodeValue, _set_nodeValue) # nodeName is an alias for target def _get_nodeName(self): return self.target def _set_nodeName(self, value): self.target = value nodeName = property(_get_nodeName, _set_nodeName) def writexml(self, writer, indent="", addindent="", newl=""): writer.write("%s%s" % (indent,self.target, self.data, newl)) class CharacterData(Childless, Node): __slots__=('_data', 'ownerDocument','parentNode', 'previousSibling', 'nextSibling') def __init__(self): self.ownerDocument = self.parentNode = None self.previousSibling = self.nextSibling = None self._data = '' Node.__init__(self) def _get_length(self): return len(self.data) __len__ = _get_length def _get_data(self): return self._data def _set_data(self, data): self._data = data data = nodeValue = property(_get_data, _set_data) def __repr__(self): data = self.data if len(data) > 10: dotdotdot = "..." else: dotdotdot = "" return '' % ( self.__class__.__name__, data[0:10], dotdotdot) def substringData(self, offset, count): if offset < 0: raise xml.dom.IndexSizeErr("offset cannot be negative") if offset >= len(self.data): raise xml.dom.IndexSizeErr("offset cannot be beyond end of data") if count < 0: raise xml.dom.IndexSizeErr("count cannot be negative") return self.data[offset:offset+count] def appendData(self, arg): self.data = self.data + arg def insertData(self, offset, arg): if offset < 0: raise xml.dom.IndexSizeErr("offset cannot be negative") if offset >= len(self.data): raise xml.dom.IndexSizeErr("offset cannot be beyond end of data") if arg: self.data = "%s%s%s" % ( self.data[:offset], arg, self.data[offset:]) def deleteData(self, offset, count): if offset < 0: raise xml.dom.IndexSizeErr("offset cannot be negative") if offset >= len(self.data): raise xml.dom.IndexSizeErr("offset cannot be beyond end of data") if count < 0: raise xml.dom.IndexSizeErr("count cannot be negative") if count: self.data = self.data[:offset] + self.data[offset+count:] def replaceData(self, offset, count, arg): if offset < 0: raise xml.dom.IndexSizeErr("offset cannot be negative") if offset >= len(self.data): raise xml.dom.IndexSizeErr("offset cannot be beyond end of data") if count < 0: raise xml.dom.IndexSizeErr("count cannot be negative") if count: self.data = "%s%s%s" % ( self.data[:offset], arg, self.data[offset+count:]) defproperty(CharacterData, "length", doc="Length of the string data.") class Text(CharacterData): __slots__ = () nodeType = Node.TEXT_NODE nodeName = "#text" attributes = None def splitText(self, offset): if offset < 0 or offset > len(self.data): raise xml.dom.IndexSizeErr("illegal offset value") newText = self.__class__() newText.data = self.data[offset:] newText.ownerDocument = self.ownerDocument next = self.nextSibling if self.parentNode and self in self.parentNode.childNodes: if next is None: self.parentNode.appendChild(newText) else: self.parentNode.insertBefore(newText, next) self.data = self.data[:offset] return newText def writexml(self, writer, indent="", addindent="", newl=""): _write_data(writer, "%s%s%s" % (indent, self.data, newl)) # DOM Level 3 (WD 9 April 2002) def _get_wholeText(self): L = [self.data] n = self.previousSibling while n is not None: if n.nodeType in (Node.TEXT_NODE, Node.CDATA_SECTION_NODE): L.insert(0, n.data) n = n.previousSibling else: break n = self.nextSibling while n is not None: if n.nodeType in (Node.TEXT_NODE, Node.CDATA_SECTION_NODE): L.append(n.data) n = n.nextSibling else: break return ''.join(L) def replaceWholeText(self, content): # XXX This needs to be seriously changed if minidom ever # supports EntityReference nodes. parent = self.parentNode n = self.previousSibling while n is not None: if n.nodeType in (Node.TEXT_NODE, Node.CDATA_SECTION_NODE): next = n.previousSibling parent.removeChild(n) n = next else: break n = self.nextSibling if not content: parent.removeChild(self) while n is not None: if n.nodeType in (Node.TEXT_NODE, Node.CDATA_SECTION_NODE): next = n.nextSibling parent.removeChild(n) n = next else: break if content: self.data = content return self else: return None def _get_isWhitespaceInElementContent(self): if self.data.strip(): return False elem = _get_containing_element(self) if elem is None: return False info = self.ownerDocument._get_elem_info(elem) if info is None: return False else: return info.isElementContent() defproperty(Text, "isWhitespaceInElementContent", doc="True iff this text node contains only whitespace" " and is in element content.") defproperty(Text, "wholeText", doc="The text of all logically-adjacent text nodes.") def _get_containing_element(node): c = node.parentNode while c is not None: if c.nodeType == Node.ELEMENT_NODE: return c c = c.parentNode return None def _get_containing_entref(node): c = node.parentNode while c is not None: if c.nodeType == Node.ENTITY_REFERENCE_NODE: return c c = c.parentNode return None class Comment(CharacterData): nodeType = Node.COMMENT_NODE nodeName = "#comment" def __init__(self, data): CharacterData.__init__(self) self._data = data def writexml(self, writer, indent="", addindent="", newl=""): if "--" in self.data: raise ValueError("'--' is not allowed in a comment node") writer.write("%s%s" % (indent, self.data, newl)) class CDATASection(Text): __slots__ = () nodeType = Node.CDATA_SECTION_NODE nodeName = "#cdata-section" def writexml(self, writer, indent="", addindent="", newl=""): if self.data.find("]]>") >= 0: raise ValueError("']]>' not allowed in a CDATA section") writer.write("" % self.data) class ReadOnlySequentialNamedNodeMap(object): __slots__ = '_seq', def __init__(self, seq=()): # seq should be a list or tuple self._seq = seq def __len__(self): return len(self._seq) def _get_length(self): return len(self._seq) def getNamedItem(self, name): for n in self._seq: if n.nodeName == name: return n def getNamedItemNS(self, namespaceURI, localName): for n in self._seq: if n.namespaceURI == namespaceURI and n.localName == localName: return n def __getitem__(self, name_or_tuple): if isinstance(name_or_tuple, tuple): node = self.getNamedItemNS(*name_or_tuple) else: node = self.getNamedItem(name_or_tuple) if node is None: raise KeyError(name_or_tuple) return node def item(self, index): if index < 0: return None try: return self._seq[index] except IndexError: return None def removeNamedItem(self, name): raise xml.dom.NoModificationAllowedErr( "NamedNodeMap instance is read-only") def removeNamedItemNS(self, namespaceURI, localName): raise xml.dom.NoModificationAllowedErr( "NamedNodeMap instance is read-only") def setNamedItem(self, node): raise xml.dom.NoModificationAllowedErr( "NamedNodeMap instance is read-only") def setNamedItemNS(self, node): raise xml.dom.NoModificationAllowedErr( "NamedNodeMap instance is read-only") def __getstate__(self): return [self._seq] def __setstate__(self, state): self._seq = state[0] defproperty(ReadOnlySequentialNamedNodeMap, "length", doc="Number of entries in the NamedNodeMap.") class Identified: """Mix-in class that supports the publicId and systemId attributes.""" __slots__ = 'publicId', 'systemId' def _identified_mixin_init(self, publicId, systemId): self.publicId = publicId self.systemId = systemId def _get_publicId(self): return self.publicId def _get_systemId(self): return self.systemId class DocumentType(Identified, Childless, Node): nodeType = Node.DOCUMENT_TYPE_NODE nodeValue = None name = None publicId = None systemId = None internalSubset = None def __init__(self, qualifiedName): self.entities = ReadOnlySequentialNamedNodeMap() self.notations = ReadOnlySequentialNamedNodeMap() if qualifiedName: prefix, localname = _nssplit(qualifiedName) self.name = localname self.nodeName = self.name def _get_internalSubset(self): return self.internalSubset def cloneNode(self, deep): if self.ownerDocument is None: # it's ok clone = DocumentType(None) clone.name = self.name clone.nodeName = self.name operation = xml.dom.UserDataHandler.NODE_CLONED if deep: clone.entities._seq = [] clone.notations._seq = [] for n in self.notations._seq: notation = Notation(n.nodeName, n.publicId, n.systemId) clone.notations._seq.append(notation) n._call_user_data_handler(operation, n, notation) for e in self.entities._seq: entity = Entity(e.nodeName, e.publicId, e.systemId, e.notationName) entity.actualEncoding = e.actualEncoding entity.encoding = e.encoding entity.version = e.version clone.entities._seq.append(entity) e._call_user_data_handler(operation, e, entity) self._call_user_data_handler(operation, self, clone) return clone else: return None def writexml(self, writer, indent="", addindent="", newl=""): writer.write(""+newl) class Entity(Identified, Node): attributes = None nodeType = Node.ENTITY_NODE nodeValue = None actualEncoding = None encoding = None version = None def __init__(self, name, publicId, systemId, notation): self.nodeName = name self.notationName = notation self.childNodes = NodeList() self._identified_mixin_init(publicId, systemId) def _get_actualEncoding(self): return self.actualEncoding def _get_encoding(self): return self.encoding def _get_version(self): return self.version def appendChild(self, newChild): raise xml.dom.HierarchyRequestErr( "cannot append children to an entity node") def insertBefore(self, newChild, refChild): raise xml.dom.HierarchyRequestErr( "cannot insert children below an entity node") def removeChild(self, oldChild): raise xml.dom.HierarchyRequestErr( "cannot remove children from an entity node") def replaceChild(self, newChild, oldChild): raise xml.dom.HierarchyRequestErr( "cannot replace children of an entity node") class Notation(Identified, Childless, Node): nodeType = Node.NOTATION_NODE nodeValue = None def __init__(self, name, publicId, systemId): self.nodeName = name self._identified_mixin_init(publicId, systemId) class DOMImplementation(DOMImplementationLS): _features = [("core", "1.0"), ("core", "2.0"), ("core", None), ("xml", "1.0"), ("xml", "2.0"), ("xml", None), ("ls-load", "3.0"), ("ls-load", None), ] def hasFeature(self, feature, version): if version == "": version = None return (feature.lower(), version) in self._features def createDocument(self, namespaceURI, qualifiedName, doctype): if doctype and doctype.parentNode is not None: raise xml.dom.WrongDocumentErr( "doctype object owned by another DOM tree") doc = self._create_document() add_root_element = not (namespaceURI is None and qualifiedName is None and doctype is None) if not qualifiedName and add_root_element: # The spec is unclear what to raise here; SyntaxErr # would be the other obvious candidate. Since Xerces raises # InvalidCharacterErr, and since SyntaxErr is not listed # for createDocument, that seems to be the better choice. # XXX: need to check for illegal characters here and in # createElement. # DOM Level III clears this up when talking about the return value # of this function. If namespaceURI, qName and DocType are # Null the document is returned without a document element # Otherwise if doctype or namespaceURI are not None # Then we go back to the above problem raise xml.dom.InvalidCharacterErr("Element with no name") if add_root_element: prefix, localname = _nssplit(qualifiedName) if prefix == "xml" \ and namespaceURI != "http://www.w3.org/XML/1998/namespace": raise xml.dom.NamespaceErr("illegal use of 'xml' prefix") if prefix and not namespaceURI: raise xml.dom.NamespaceErr( "illegal use of prefix without namespaces") element = doc.createElementNS(namespaceURI, qualifiedName) if doctype: doc.appendChild(doctype) doc.appendChild(element) if doctype: doctype.parentNode = doctype.ownerDocument = doc doc.doctype = doctype doc.implementation = self return doc def createDocumentType(self, qualifiedName, publicId, systemId): doctype = DocumentType(qualifiedName) doctype.publicId = publicId doctype.systemId = systemId return doctype # DOM Level 3 (WD 9 April 2002) def getInterface(self, feature): if self.hasFeature(feature, None): return self else: return None # internal def _create_document(self): return Document() class ElementInfo(object): """Object that represents content-model information for an element. This implementation is not expected to be used in practice; DOM builders should provide implementations which do the right thing using information available to it. """ __slots__ = 'tagName', def __init__(self, name): self.tagName = name def getAttributeType(self, aname): return _no_type def getAttributeTypeNS(self, namespaceURI, localName): return _no_type def isElementContent(self): return False def isEmpty(self): """Returns true iff this element is declared to have an EMPTY content model.""" return False def isId(self, aname): """Returns true iff the named attribute is a DTD-style ID.""" return False def isIdNS(self, namespaceURI, localName): """Returns true iff the identified attribute is a DTD-style ID.""" return False def __getstate__(self): return self.tagName def __setstate__(self, state): self.tagName = state def _clear_id_cache(node): if node.nodeType == Node.DOCUMENT_NODE: node._id_cache.clear() node._id_search_stack = None elif _in_document(node): node.ownerDocument._id_cache.clear() node.ownerDocument._id_search_stack= None class Document(Node, DocumentLS): __slots__ = ('_elem_info', 'doctype', '_id_search_stack', 'childNodes', '_id_cache') _child_node_types = (Node.ELEMENT_NODE, Node.PROCESSING_INSTRUCTION_NODE, Node.COMMENT_NODE, Node.DOCUMENT_TYPE_NODE) implementation = DOMImplementation() nodeType = Node.DOCUMENT_NODE nodeName = "#document" nodeValue = None attributes = None parentNode = None previousSibling = nextSibling = None # Document attributes from Level 3 (WD 9 April 2002) actualEncoding = None encoding = None standalone = None version = None strictErrorChecking = False errorHandler = None documentURI = None _magic_id_count = 0 def __init__(self): self.doctype = None self.childNodes = NodeList() # mapping of (namespaceURI, localName) -> ElementInfo # and tagName -> ElementInfo self._elem_info = {} self._id_cache = {} self._id_search_stack = None def _get_elem_info(self, element): if element.namespaceURI: key = element.namespaceURI, element.localName else: key = element.tagName return self._elem_info.get(key) def _get_actualEncoding(self): return self.actualEncoding def _get_doctype(self): return self.doctype def _get_documentURI(self): return self.documentURI def _get_encoding(self): return self.encoding def _get_errorHandler(self): return self.errorHandler def _get_standalone(self): return self.standalone def _get_strictErrorChecking(self): return self.strictErrorChecking def _get_version(self): return self.version def appendChild(self, node): if node.nodeType not in self._child_node_types: raise xml.dom.HierarchyRequestErr( "%s cannot be child of %s" % (repr(node), repr(self))) if node.parentNode is not None: # This needs to be done before the next test since this # may *be* the document element, in which case it should # end up re-ordered to the end. node.parentNode.removeChild(node) if node.nodeType == Node.ELEMENT_NODE \ and self._get_documentElement(): raise xml.dom.HierarchyRequestErr( "two document elements disallowed") return Node.appendChild(self, node) def removeChild(self, oldChild): try: self.childNodes.remove(oldChild) except ValueError: raise xml.dom.NotFoundErr() oldChild.nextSibling = oldChild.previousSibling = None oldChild.parentNode = None if self.documentElement is oldChild: self.documentElement = None return oldChild def _get_documentElement(self): for node in self.childNodes: if node.nodeType == Node.ELEMENT_NODE: return node def unlink(self): if self.doctype is not None: self.doctype.unlink() self.doctype = None Node.unlink(self) def cloneNode(self, deep): if not deep: return None clone = self.implementation.createDocument(None, None, None) clone.encoding = self.encoding clone.standalone = self.standalone clone.version = self.version for n in self.childNodes: childclone = _clone_node(n, deep, clone) assert childclone.ownerDocument.isSameNode(clone) clone.childNodes.append(childclone) if childclone.nodeType == Node.DOCUMENT_NODE: assert clone.documentElement is None elif childclone.nodeType == Node.DOCUMENT_TYPE_NODE: assert clone.doctype is None clone.doctype = childclone childclone.parentNode = clone self._call_user_data_handler(xml.dom.UserDataHandler.NODE_CLONED, self, clone) return clone def createDocumentFragment(self): d = DocumentFragment() d.ownerDocument = self return d def createElement(self, tagName): e = Element(tagName) e.ownerDocument = self return e def createTextNode(self, data): if not isinstance(data, str): raise TypeError("node contents must be a string") t = Text() t.data = data t.ownerDocument = self return t def createCDATASection(self, data): if not isinstance(data, str): raise TypeError("node contents must be a string") c = CDATASection() c.data = data c.ownerDocument = self return c def createComment(self, data): c = Comment(data) c.ownerDocument = self return c def createProcessingInstruction(self, target, data): p = ProcessingInstruction(target, data) p.ownerDocument = self return p def createAttribute(self, qName): a = Attr(qName) a.ownerDocument = self a.value = "" return a def createElementNS(self, namespaceURI, qualifiedName): prefix, localName = _nssplit(qualifiedName) e = Element(qualifiedName, namespaceURI, prefix) e.ownerDocument = self return e def createAttributeNS(self, namespaceURI, qualifiedName): prefix, localName = _nssplit(qualifiedName) a = Attr(qualifiedName, namespaceURI, localName, prefix) a.ownerDocument = self a.value = "" return a # A couple of implementation-specific helpers to create node types # not supported by the W3C DOM specs: def _create_entity(self, name, publicId, systemId, notationName): e = Entity(name, publicId, systemId, notationName) e.ownerDocument = self return e def _create_notation(self, name, publicId, systemId): n = Notation(name, publicId, systemId) n.ownerDocument = self return n def getElementById(self, id): if id in self._id_cache: return self._id_cache[id] if not (self._elem_info or self._magic_id_count): return None stack = self._id_search_stack if stack is None: # we never searched before, or the cache has been cleared stack = [self.documentElement] self._id_search_stack = stack elif not stack: # Previous search was completed and cache is still valid; # no matching node. return None result = None while stack: node = stack.pop() # add child elements to stack for continued searching stack.extend([child for child in node.childNodes if child.nodeType in _nodeTypes_with_children]) # check this node info = self._get_elem_info(node) if info: # We have to process all ID attributes before # returning in order to get all the attributes set to # be IDs using Element.setIdAttribute*(). for attr in node.attributes.values(): if attr.namespaceURI: if info.isIdNS(attr.namespaceURI, attr.localName): self._id_cache[attr.value] = node if attr.value == id: result = node elif not node._magic_id_nodes: break elif info.isId(attr.name): self._id_cache[attr.value] = node if attr.value == id: result = node elif not node._magic_id_nodes: break elif attr._is_id: self._id_cache[attr.value] = node if attr.value == id: result = node elif node._magic_id_nodes == 1: break elif node._magic_id_nodes: for attr in node.attributes.values(): if attr._is_id: self._id_cache[attr.value] = node if attr.value == id: result = node if result is not None: break return result def getElementsByTagName(self, name): return _get_elements_by_tagName_helper(self, name, NodeList()) def getElementsByTagNameNS(self, namespaceURI, localName): return _get_elements_by_tagName_ns_helper( self, namespaceURI, localName, NodeList()) def isSupported(self, feature, version): return self.implementation.hasFeature(feature, version) def importNode(self, node, deep): if node.nodeType == Node.DOCUMENT_NODE: raise xml.dom.NotSupportedErr("cannot import document nodes") elif node.nodeType == Node.DOCUMENT_TYPE_NODE: raise xml.dom.NotSupportedErr("cannot import document type nodes") return _clone_node(node, deep, self) def writexml(self, writer, indent="", addindent="", newl="", encoding=None, standalone=None): declarations = [] if encoding: declarations.append(f'encoding="{encoding}"') if standalone is not None: declarations.append(f'standalone="{"yes" if standalone else "no"}"') writer.write(f'{newl}') for node in self.childNodes: node.writexml(writer, indent, addindent, newl) # DOM Level 3 (WD 9 April 2002) def renameNode(self, n, namespaceURI, name): if n.ownerDocument is not self: raise xml.dom.WrongDocumentErr( "cannot rename nodes from other documents;\n" "expected %s,\nfound %s" % (self, n.ownerDocument)) if n.nodeType not in (Node.ELEMENT_NODE, Node.ATTRIBUTE_NODE): raise xml.dom.NotSupportedErr( "renameNode() only applies to element and attribute nodes") if namespaceURI != EMPTY_NAMESPACE: if ':' in name: prefix, localName = name.split(':', 1) if ( prefix == "xmlns" and namespaceURI != xml.dom.XMLNS_NAMESPACE): raise xml.dom.NamespaceErr( "illegal use of 'xmlns' prefix") else: if ( name == "xmlns" and namespaceURI != xml.dom.XMLNS_NAMESPACE and n.nodeType == Node.ATTRIBUTE_NODE): raise xml.dom.NamespaceErr( "illegal use of the 'xmlns' attribute") prefix = None localName = name else: prefix = None localName = None if n.nodeType == Node.ATTRIBUTE_NODE: element = n.ownerElement if element is not None: is_id = n._is_id element.removeAttributeNode(n) else: element = None n.prefix = prefix n._localName = localName n.namespaceURI = namespaceURI n.nodeName = name if n.nodeType == Node.ELEMENT_NODE: n.tagName = name else: # attribute node n.name = name if element is not None: element.setAttributeNode(n) if is_id: element.setIdAttributeNode(n) # It's not clear from a semantic perspective whether we should # call the user data handlers for the NODE_RENAMED event since # we're re-using the existing node. The draft spec has been # interpreted as meaning "no, don't call the handler unless a # new node is created." return n defproperty(Document, "documentElement", doc="Top-level element of this document.") def _clone_node(node, deep, newOwnerDocument): """ Clone a node and give it the new owner document. Called by Node.cloneNode and Document.importNode """ if node.ownerDocument.isSameNode(newOwnerDocument): operation = xml.dom.UserDataHandler.NODE_CLONED else: operation = xml.dom.UserDataHandler.NODE_IMPORTED if node.nodeType == Node.ELEMENT_NODE: clone = newOwnerDocument.createElementNS(node.namespaceURI, node.nodeName) for attr in node.attributes.values(): clone.setAttributeNS(attr.namespaceURI, attr.nodeName, attr.value) a = clone.getAttributeNodeNS(attr.namespaceURI, attr.localName) a.specified = attr.specified if deep: for child in node.childNodes: c = _clone_node(child, deep, newOwnerDocument) clone.appendChild(c) elif node.nodeType == Node.DOCUMENT_FRAGMENT_NODE: clone = newOwnerDocument.createDocumentFragment() if deep: for child in node.childNodes: c = _clone_node(child, deep, newOwnerDocument) clone.appendChild(c) elif node.nodeType == Node.TEXT_NODE: clone = newOwnerDocument.createTextNode(node.data) elif node.nodeType == Node.CDATA_SECTION_NODE: clone = newOwnerDocument.createCDATASection(node.data) elif node.nodeType == Node.PROCESSING_INSTRUCTION_NODE: clone = newOwnerDocument.createProcessingInstruction(node.target, node.data) elif node.nodeType == Node.COMMENT_NODE: clone = newOwnerDocument.createComment(node.data) elif node.nodeType == Node.ATTRIBUTE_NODE: clone = newOwnerDocument.createAttributeNS(node.namespaceURI, node.nodeName) clone.specified = True clone.value = node.value elif node.nodeType == Node.DOCUMENT_TYPE_NODE: assert node.ownerDocument is not newOwnerDocument operation = xml.dom.UserDataHandler.NODE_IMPORTED clone = newOwnerDocument.implementation.createDocumentType( node.name, node.publicId, node.systemId) clone.ownerDocument = newOwnerDocument if deep: clone.entities._seq = [] clone.notations._seq = [] for n in node.notations._seq: notation = Notation(n.nodeName, n.publicId, n.systemId) notation.ownerDocument = newOwnerDocument clone.notations._seq.append(notation) if hasattr(n, '_call_user_data_handler'): n._call_user_data_handler(operation, n, notation) for e in node.entities._seq: entity = Entity(e.nodeName, e.publicId, e.systemId, e.notationName) entity.actualEncoding = e.actualEncoding entity.encoding = e.encoding entity.version = e.version entity.ownerDocument = newOwnerDocument clone.entities._seq.append(entity) if hasattr(e, '_call_user_data_handler'): e._call_user_data_handler(operation, e, entity) else: # Note the cloning of Document and DocumentType nodes is # implementation specific. minidom handles those cases # directly in the cloneNode() methods. raise xml.dom.NotSupportedErr("Cannot clone node %s" % repr(node)) # Check for _call_user_data_handler() since this could conceivably # used with other DOM implementations (one of the FourThought # DOMs, perhaps?). if hasattr(node, '_call_user_data_handler'): node._call_user_data_handler(operation, node, clone) return clone def _nssplit(qualifiedName): fields = qualifiedName.split(':', 1) if len(fields) == 2: return fields else: return (None, fields[0]) def _do_pulldom_parse(func, args, kwargs): events = func(*args, **kwargs) toktype, rootNode = events.getEvent() events.expandNode(rootNode) events.clear() return rootNode def parse(file, parser=None, bufsize=None): """Parse a file into a DOM by filename or file object.""" if parser is None and not bufsize: from xml.dom import expatbuilder return expatbuilder.parse(file) else: from xml.dom import pulldom return _do_pulldom_parse(pulldom.parse, (file,), {'parser': parser, 'bufsize': bufsize}) def parseString(string, parser=None): """Parse a file into a DOM from a string.""" if parser is None: from xml.dom import expatbuilder return expatbuilder.parseString(string) else: from xml.dom import pulldom return _do_pulldom_parse(pulldom.parseString, (string,), {'parser': parser}) def getDOMImplementation(features=None): if features: if isinstance(features, str): features = domreg._parse_feature_string(features) for f, v in features: if not Document.implementation.hasFeature(f, v): return None return Document.implementation PKN\g0dom/__pycache__/minicompat.cpython-311.opt-1.pycnu[ !A?h' ^dZgdZddlZefZGddeZGddeZ dZ dS) zPython version compatibility support for minidom. This module contains internal implementation details and should not be imported; use xml.dom.minidom instead. )NodeList EmptyNodeList StringTypes defpropertyNcFeZdZdZdZdZdZeeedZdZ dS) rcRd|cxkrt|kr ndS||SdSNrlenselfindexs ?/opt/alt/python-internal/lib64/python3.11/xml/dom/minicompat.pyitemz NodeList.item5s?  ! ! ! !D ! ! ! ! ! !;  " !c t|SNr rs r _get_lengthzNodeList._get_length9s4yyrc@tjdNz.attempt to modify read-only attribute 'length'xmldomNoModificationAllowedErrrvalues r _set_lengthzNodeList._set_length<g.. <>> >r$The number of nodes in the NodeList.docc|g}||dd<dSrr)rstates r __setstate__zNodeList.__setstate__Ds =EQQQrN) __name__ __module__ __qualname__ __slots__rrrpropertylengthr&rrrrr2swI>>>Xk;@BBBFrrcLeZdZdZdZdZdZdZdZe eedZ d S) rrcLt}|||SrrextendrotherNLs r__add__zEmptyNodeList.__add__M" ZZ % rcLt}|||Srr/r1s r__radd__zEmptyNodeList.__radd__Rr5rcdSrrr s rrzEmptyNodeList.itemWstrcdSr rrs rrzEmptyNodeList._get_lengthZsqrc@tjdrrrs rrzEmptyNodeList._set_length]r rr!r"N) r'r(r)r*r4r7rrrr+r,rrrrrJsI  >>>Xk;@BBBFFFrrc|t|d|z}|fd}t|||}t|||dS)N_get_c`tjdt|z)Nz&attempt to modify read-only attribute )rrrrepr)rrnames rsetzdefproperty..setgs-g.. 4tDzz ACC Crr")getattrr+setattr)klassr?r#getr@props rrres^ %'D. * *C"CCCC C# & & &D E4r) __doc____all__xml.domrstrrlistrtuplerrrrrrLsT F E Ef t0BBBBBEBBB6rPKN\YFF0dom/__pycache__/xmlbuilder.cpython-311.opt-1.pycnu[ !A?hc0dZddlZddlZddlmZgdZGddZGddZd Z Gd d e Z Gd d e Z GddZ [GddZGddZdS)z4Implementation of the DOM Level 3 'LS-Load' feature.N) NodeFilter) DOMBuilderDOMEntityResolverDOMInputSourcec^eZdZdZdZdZdZdZdZdZ dZ dZ dZ dZ dZdZdZdZdZdZdZdZdZdS)OptionszFeatures object that has variables set for each DOMBuilder feature. The DOMBuilder class uses an instance of this class to pass settings to the ExpatBuilder class. TFN)__name__ __module__ __qualname____doc__ namespacesnamespace_declarations validationexternal_parameter_entitiesexternal_general_entitiesexternal_dtd_subsetvalidate_if_schemavalidatedatatype_normalizationcreate_entity_ref_nodesentitieswhitespace_in_element_contentcdata_sectionscommentscharset_overrides_xml_encodinginfosetsupported_mediatypes_only errorHandlerfilter?/opt/alt/python-internal/lib64/python3.11/xml/dom/xmlbuilder.pyrr sJ!J"& $H""H$(!NH%)"G %L FFFr"rc DeZdZdZdZdZdZdZdZdZ eeee fZ dZ dZ dZ d Zd Zd Zd Zd ZdZdZiddgddgddgddgddgddgddgddgddgddgdddgddgddgddgddgddgd d gd!gd"gd#gggd$d%gd&gd'gd(Zd)Zd*Zd+Zd,Zd-ZdS).rNr c,t|_dSN)r_optionsselfs r#__init__zDOMBuilder.__init__9s  r"c|jSr)entityResolverr+s r#_get_entityResolverzDOMBuilder._get_entityResolver<s ""r"c||_dSr)r/)r,r0s r#_set_entityResolverzDOMBuilder._set_entityResolver>s,r"c|jSr)rr+s r#_get_errorHandlerzDOMBuilder._get_errorHandlerAs   r"c||_dSr)r5)r,rs r#_set_errorHandlerzDOMBuilder._set_errorHandlerCs(r"c|jSr)r r+s r# _get_filterzDOMBuilder._get_filterFs {r"c||_dSr)r:)r,r s r# _set_filterzDOMBuilder._set_filterHs  r"cr||rt|rdpd} |jt||f}|D]\}}t|j||dS#t $r$t jd|dwxYwt j dt|z)Nr rzunsupported feature: zunknown feature: ) supportsFeature _settings _name_xformsetattrr*KeyErrorxmldomNotSupportedErr NotFoundErrrepr)r,namestatesettingsvalues r# setFeaturezDOMBuilder.setFeatureKs    % % HKa$1E 8>;t+<+BC C'%%&9DJJ&FGG Gs A.BcFt|jt|Sr))hasattrr*rA)r,rIs r#r?zDOMBuilder.supportsFeatureYst}k$&7&7888r"c>t||rdpdf}||jvS)Nr r)rAr@)r,rIrJkeys r# canSetFeaturezDOMBuilder.canSetFeature\s*4  %+A"23dn$$r"rr)rr )rr)rr)rr )rr)rr rrrr)rr rr)rr )rrrr rr)rr )rrrr rrrr ) rSrTrUrVrX)rr rWrYr[rrrrrr )rYrZr[)rr)rr r\r]r^cdt|} t|j|S#t$r|dkrI|j}|jo8|jo1|jo*|jo#|jp|j p|j p |j p|j cYStjdt!|zwxYw)Nrzfeature %s not known)rAgetattrr*AttributeErrorrrrrrrrrrrDrErGrH)r,rIxnameoptionss r# getFeaturezDOMBuilder.getFeaturesD!! K4=%00 0 K K Ky  -6<#A<#,<$B<")!?";$+$>";$+$C";%,$4";%,$: < ==='%%& =EE   , ,'**,, ,{{}}r"N) r r r r async_rrrrrrr!r"r#rrNs|GG FBBB 777 >>>>>>r"rc(eZdZdZdZdZdZdZdS)DOMImplementationLSr r%c|tjd||jkrt S||jkrtjdt d)NzschemaType not yet supportedz'asynchronous builders are not supportedzunknown value for mode)rDrErFMODE_SYNCHRONOUSrMODE_ASYNCHRONOUSrx)r,mode schemaTypes r#createDOMBuilderz$DOMImplementationLS.createDOMBuilderssw  !')).00 0 4( ( (<<  4) ) )'))9;; ;1222r"c td)Nz-the writer interface hasn't been written yet!rr+s r#createDOMWriterz#DOMImplementationLS.createDOMWriter~s! ;== =r"ctSr))rr+s r#createDOMInputSourcez(DOMImplementationLS.createDOMInputSourcesr"N)r r r r r rrrr!r"r#rrosM 3 3 3===     r"r)r rmxml.domrDxml.dom.NodeFilterr__all__rrrAobjectrrrrrr!r"r#rs:: )))))) @ ? ?@a)a)a)a)a)a)a)a)H***):):):):):):):):X.....V...b""""""""4B          r"PKN\d@v@v-dom/__pycache__/minidom.cpython-311.opt-1.pycnu[ !A?h, dZddlZddlZddlmZmZmZmZddlTddl m Z m Z ej j jej j jfZGddej j Z ee dd ee d d ee d d dZdZdZdZdZGdde ZGdde Zeedd eed d eedd GddeZeedd eZGd!d"eZeddZGd#d$e Zeed%d& eed d' d(ZGd)d*Z Gd+d,e e Z!Gd-d.e e Z"ee"dd/ Gd0d1e"Z#ee#d2d3 ee#d4d5 d6Z$d7Z%Gd8d9e"Z&Gd:d;e#Z'Gd<d=eZ(ee(dd> Gd?d@Z)GdAdBe)e e Z*GdCdDe)e Z+GdEdFe)e e Z,GdGdHe Z-GdIdJeZ.dKZ/GdLdMe e Z0ee0dNdO dPZ1dQZ2dRZ3dVdSZ4dWdTZ5dWdUZ6dS)XacSimple implementation of the Level 1 DOM. Namespaces and other minor Level 2 features are also supported. parse("foo.xml") parseString("") Todo: ===== * convenience methods for getting elements and text. * more testing * bring some of the writer and linearizer code into conformance with this interface * SAX 2 namespaces N)EMPTY_NAMESPACE EMPTY_PREFIXXMLNS_NAMESPACEdomreg)*)DOMImplementationLS DocumentLSceZdZdZdZdZdZdZeZ dZ ddZ ddZ dZ dZd Zd Zd Zd Zd ZdZdZdZdZdZdZdZdZdZdZdZdZdZ dS)NodeNcdS)NTselfs t jt|dt||j |j ||| |n |j |}n,#t$rt jwxYw|jt vrt#||j||||_||_|r|j|dz }||_||_nd|_||_ |S)N cannot be child of )r%DOCUMENT_FRAGMENT_NODEtupler0 insertBefore_child_node_typesxmldomHierarchyRequestErrrepr parentNode removeChild appendChildindex ValueError NotFoundErr_nodeTypes_with_children_clear_id_cacheinsert nextSiblingpreviousSibling)rnewChildrefChildcrKnodes rrBzNode.insertBeforeRs   ; ; ;8.// / /!!!X....O  D$: : :'--.28nnnnd4jjjIKK K   *   + +H 5 5 5     X & & & & ,--h77 , , ,g))+++ , $<<<%%% O " "5( 3 3 3#+H '/H $ 0uQw/#+ +/((+/("&H s C!!)D c|j|jkr.t|jD]}|||S|j|jvr>t jt|dt||jtvrt||j |j |t||d|_|SNr>)r%r@rAr0rJrCrDrErFrGrNrOrHrI _append_childrQ)rrVrUs rrJzNode.appendChildrs =D7 7 74?++ $ $  ####K = 6 6 6'--.24jjjj$t***EGG G ]6 6 6 D ! ! ! ? & O ' ' - - -dD!!! rc|j|jkr2|j}|||||S|j|jvr>t jt|dt|||urdS|j |j | |j |}n,#t$rt jwxYw||j |<||_ d|_ |jtvs|jtvrt!||j|_|j|_d|_d|_|jr ||j_|jr ||j_|SrX)r%r@rQrIrBrCrDrErFrGrHr0rKrLrMrNrOrR)rrSoldChildrTrKs r replaceChildzNode.replaceChilds   ; ; ;+H   X & & &$$Xx88 8  D$: : :'--.28nnnnd4jjjIKK K x   F   *   + +H 5 5 5 (O))(33EE ( ( ('%%'' ' (!)""  !9 9 9 $<<< D ! ! !'3#+#; ##'  # <3;H $ 0   <3;H 0s 7C)C;cZ |j|n,#t$rtjwxYw|j|j|j_|j|j|j_dx|_|_|jtvrt|d|_ |Sr.) r0removerLrDrErMrQrRr%rNrOrHrr[s rrIzNode.removeChilds ( O " "8 , , , , ( ( ('%%'' ' (   +3;3KH 0  # /3;3GH $ 0:>>x7   8 8 8 D ! ! !" )Aclg}|jD]}|jtjkr|jsA|r|j|d_|jr|j|j_|`|rf|dj|jkrP|d}|j|jz|_|j|_|jr ||j_||||||jtj kr| ||jdd<dSr:) r0r%r TEXT_NODEdatarQrRunlinkappend ELEMENT_NODE normalize)rLchildrVs rrgzNode.normalizes, _ & &E~//z$>,1,=")(RU^;;R5D $ EJ 6DI','8D$(A<@)9LLNNNNHHUOOOO>T%666OO%%%rc2t|||jp|Sr.) _clone_node ownerDocument)rdeeps r cloneNodezNode.cloneNodes4t'9'ATBBBrcB|jj||Sr.)rlimplementation hasFeaturerfeatureversions r isSupportedzNode.isSupporteds!0;;GWMMMrcdSr.r rs r_get_localNamezNode._get_localNamestrc ||uSr.r rothers r isSameNodezNode.isSameNodes u}rc6||dr|SdSr.)rurrss r getInterfacezNode.getInterfaces$   GT * * K4rcZ |j|dS#ttf$rYdSwxYwr7) _user_dataAttributeErrorKeyErrorrkeys r getUserDatazNode.getUserDatas@ ?3'* *)   44 s **cd} |j}n#t$r i}||_YnwxYw||vr||d}|d}|||=n||f||<|Sr7)rr)rrrchandleroldds r setUserDatazNode.setUserDatas AA   ADOOO  !88C&)C <GcFG_AcF s  ""ct|drJt|jD]%\}\}}|||||||$dSdS)Nr)hasattrlistritemshandle)r operationsrcdstrrcrs r_call_user_data_handlerzNode._call_user_data_handlers~ 4 & & C(,T_-B-B-D-D(E(E C C$_dG&NN9c4cBBB C C C Crcdx|_|_|jr1|jD]}|t |_d|_d|_dSr.)rHrlr0rdNodeListrRrQ)rris rrdz Node.unlinks\/33$, ? )   &jjDO#rc|Sr.r rs r __enter__zNode.__enter__s rc.|dSr.)rd)retevtbs r__exit__z Node.__exit__s rNN)rrNN)!__name__ __module__ __qualname__ namespaceURIrHrlrQrRrprefixrrrr1r4r8r<rBrJr\rIrgrnrurwr{r~rrrrdrrr rrr r "sLJMKO F>>>><@#....&%%%&&&'''@"@ 6CCCNNN  $CCC   rr firstChildzFirst child node, or None.)doc lastChildzLast child node, or None. localNamez"Namespace-local name of this node.c||j}|r|d}||_||_||||_dSr:)r0rRrQrerH)rrVr0lasts rrYrYsIJ "~#dDOOOrcJ| |jtjkrdS|j}| dSNTF)r%r r&rHrVs r _in_documentr's3   =D. . .4   5rc|ri|dddddddd}||d Sd S) zWrites datachars to writer.&z&z>N)replacewrite)r,rcs r _write_datar/so ||C))11#v>>GD(++GGC,@,@  Trc|jD]N}|jtjkr&|dks |j|kr||t |||O|SNr)r0r%r rftagNamere_get_elements_by_tagName_helper)parentnamercrVs rrr6sb!88 =D- - - S[[DLD00 IIdOOO'dB7777 Irc|jD]`}|jtjkrI|dks |j|kr&|dks |j|kr||t||||a|Sr)r0r%r rfrrre"_get_elements_by_tagName_ns_helper)rnsURIrrrVs rrr>s|!KK =D- - -c!!T^y%@%@#!2e!;!; $ .tUIr J J J IrceZdZejZdZdZdZdZ ej ej ej ej ejejejfZdZdS)DocumentFragmentz#document-fragmentNc,t|_dSr.)rr0rs r__init__zDocumentFragment.__init__Us"**r)rrrr r@r%nodeName nodeValue attributesrHrfrbCDATA_SECTION_NODEENTITY_REFERENCE_NODEPROCESSING_INSTRUCTION_NODE COMMENT_NODE NOTATION_NODErCrr rrrrGsp*H#HIJJ*039*+ -%%%%%rrceZdZdZejZdZdZdZ ej ej fZ e ddfdZdZdZdZdZeeexZZd Zd ZeeexZZd Zd ZeeeZd ZdZdZdS)Attr)_name_valuer_prefixr0 _localNamerl ownerElementNFcd|_||_||_||_|||_t |_|jtdSr.) rrrrrrr0reText)rqNamerrrs rrz Attr.__init__csZ  (  'DO"** tvv&&&&&rct |jS#t$r$|jdddcYSwxYwN:r?r;)rrrsplitrs rrwzAttr._get_localNamersM 3? " 3 3 3=&&sA..r2 2 2 2 3  +77c|jSr.) specifiedrs r_get_specifiedzAttr._get_specifiedx ~rc|jSr.)rrs r _get_namezAttr._get_name{ zrcN||_|jt|jdSdSr.)rrrOrvalues r _set_namezAttr._set_name~s1   ( D- . . . . . ) (rc|jSr.)rrs r _get_valuezAttr._get_value {rc||_||jd_|jt |j||jd_dSr7)rr0rcrrOrs r _set_valuezAttr._set_valuesG "'   ( D- . . ."'rc|jSr.)rrs r _get_prefixzAttr._get_prefix |rc|j}|dkr,|r*|tkrtjd||_||j}n |d|j}|jrt|j||_ dS)Nxmlnsz5illegal use of 'xmlns' prefix for the wrong namespacer) rrrDrE NamespaceErrrrrrOr)rrnsurinewNames r _set_prefixzAttr._set_prefixs! W   M/11g**KMMM >nGG!'8G   / D- . . . rc|j}|T|j|j=|j|j|jf=|jr,d|_|xjdzc_|jxj dzc_ |j D]}| |j dd=dS)NFr?) r_attrsr_attrsNSrr_is_id_magic_id_nodesrl_magic_id_countr0rd)relemris rrdz Attr.unlinks     DM* t0$.AB{ 8# $$)$$"22a722_  E LLNNNN OAAA   rc|jrdS|j}|j}||dS||}|dS|jr ||j|jS||jSr) rrlr_get_elem_inforisIdNSrisIdrrrrinfos r _get_isIdzAttr._get_isIds ; 4   ;$,5!!$'' <5   ,;;t0$.AA A99T]++ +rc|j}|j}||tS||}|tS|jr ||j|jS||jSr.) rlr_no_typerrgetAttributeTypeNSrgetAttributeTyperrs r_get_schemaTypezAttr._get_schemaTypesy   ;$,O!!$'' <O   8**4+tjt |dt ||j|j}|r| ||j|j<||j |j |j f<|j |_t|j|SrX)rrrDrErFrGrr(rrdrrrr rrO)rrVrs rr>zNamedNodeMap.setNamedItemas$%% G'--.24jjjj$t***EGG Gkoodi((   JJLLL!% DI=A t($.9: .)*** rc,||Sr.)r>rrVs rsetNamedItemNSzNamedNodeMap.setNamedItemNSns  &&&rcf||}t|j|dSr.)rOrrd)rr;rVs r __delitem__zNamedNodeMap.__delitem__qs/$%)*** rc*|j|j|jfSr.r rs r __getstate__zNamedNodeMap.__getstate__vs{DM4+===rc0|\|_|_|_dSr.r rstates r __setstate__zNamedNodeMap.__setstate__ys9>6 T]D$6$6$6rr.)!rrr__doc__rrrrrrr!rr$rr(__len__r,r/r2r4r7r9r<rArDrGrLrOr>rSrUrWr[r rrr r s8I***       ((( """$$$$$$,,,,GCCC %%%%%%$$$%%%$$$111 $ $ $  ( ( ( ( ( (   ''' >>>?????rr lengthz$Number of nodes in the NamedNodeMap.c*eZdZdZdZdZdZdZdS)TypeInfo namespacerc"||_||_dSr.ra)rrbrs rrzTypeInfo.__init__s" rc|jr d|jjd|jd|jdSd|jjd|jdS)Nr z (from z)>r)rb __class__rrrs r__repr__zTypeInfo.__repr__s` > D D*..*A*A*A4999*....: : D!% 7 7 7C Crc|jSr.)rrs rrzTypeInfo._get_name yrc|jSr.)rbrs r_get_namespacezTypeInfo._get_namespacerrN)rrrrrrgrrkr rrr`r`sX#IDDDrr`c&eZdZdZejZdZeZ dZ ejej ej ej ejejfZeddfdZdZdZdZdZd Zd Zd Zd Zd ZdZdZeZdZdZ dZ!e!Z"dZ#dZ$dZ%dZ&dZ'ddZ(dZ)dZ*dZ+dZ,dZ-dS) Element) rlrHrrrrrr0rrrQrRNrcd|_|x|_|_||_||_t |_dx|_|_d|_ d|_ dSr.) rHrrrrrr0rQrRrr)rrrrrs rrzElement.__init__sU'.. t} ("**2664/  rc4|ji|_i|_dSdSr.)rrrs r_ensure_attributeszElement._ensure_attributess$ ; DKDMMM  rct |jS#t$r$|jdddcYSwxYwr)rrrrrs rrwzElement._get_localNamesM 2? " 2 2 2<%%c1--b1 1 1 1 2rc|jSr.rrs r _get_tagNamezElement._get_tagNamerrc|j=t|jD]}|d|_d|_t |dSr.)rrrrdrr )rattrs rrdzElement.unlinksd ; "T[//1122      Drc\|jdS |j|jS#t$rYdSwxYw)aReturns the value of the specified attribute. Returns the value of the element's attribute named attname as a string. An empty string is returned if the element does not have such an attribute. Note that an empty string may also be returned as an explicitly given attribute value, use the hasAttribute method to distinguish these two cases. Nr)rrr)rr@s r getAttributezElement.getAttributesH ; 2 ;w'- -   22 s  ++c`|jdS |j||fjS#t$rYdSwxYwr)rrrrFs rgetAttributeNSzElement.getAttributeNSsK = 2 =, !:;A A   22 s  --c||}|9t|}||_|j|_||dS||jkr||_|jrt |dSdSdSr.)getAttributeNoderrrlsetAttributeNoderrO)rr@rrvs r setAttributezElement.setAttributes$$W-- <==DDJ!%!3D   ! !$ ' ' ' ' ' dj DJy &%%%%%!  & &rcXt|\}}|||}|t|||tSr.rrrFs rgetElementsByTagNameNSzElement.getElementsByTagNameNS`!1 , 8::77 7rc4d|jt|fzS)Nz)rr+rs rrgzElement.__repr__ds)T\2d88,DDDrrcB||dz|jz|}|D]J}|d|zt |||j|dK|jr|dt|jdkrN|jdjtj tj fvr$|jd |dddnO|||jD]}| |||z|||||d|jd|d S|d |zd S) zWrite an XML element to a file-like object Write the element to the writer object that must provide a write method (e.g. a file or StringIO object). rz %s="rrr?rrz%sN) rr_get_attributesrrrr0rr%r rbrr')rr,r* addindentr+ra_namerVs rr'zElement.writexmlgs  VCZ$,.///$$&&jjll  F LLF* + + + f 3 4 4 4 LL     ? ( LL   DO$$))"+(?0AAA"++FBB???? T""" OMMDMM&&*:ItLLLL V$$$ LLLdlllDD9 : : : : : LL ' ' ' ' 'rc`|t|j|j|Sr.)rpr rrrs rrzElement._get_attributess* !!!DK===rc|jrdSdSrrrs r hasAttributeszElement.hasAttributess ; 45rcZ||}||dSr.)r|setIdAttributeNode)rridAttrs rsetIdAttributezElement.setIdAttributes/&&t,, '''''rc\|||}||dSr.)rr)rrrrs rsetIdAttributeNSzElement.setIdAttributeNSs1((yAA '''''rc\|||jstjt |tj|js=d|_|xjdz c_|j xj dz c_ t|dSdS)NTr?) r{rrDrErM_get_containing_entrefNoModificationAllowedErrrrrlrrO)rrs rrzElement.setIdAttributeNodes >1D!E!E>'%%'' ' !$ ' ' 3'2244 4} " FM  A %   . .! 3 . . D ! ! ! ! !  " "rrrr).rrrrr rfr%rrr rrrrbrrrCrrrprwrtrdrxrzr~rr|rr}setAttributeNodeNSrrrremoveAttributeNodeNSrrrrrgr'rrrrrr rrrmrms1I HIJO*9*03 5.=T( 222   & & &..."))) <<< &*''''''   0###::: GGG777EEE((((@>>>(((((( " " " " "rrmrz*NamedNodeMap of attributes on the element.z%Namespace-local name of this element.ct||||j|j<||j|j|jf<||_dSr.)rOrprrrrrr)elementrvs rrrsWG    $GN49<@Gd'89  DrcfeZdZdZdZdZeZdZdZ dZ dZ dZ dZ dZd Zd Zd ZdS) ChildlesszMixin that makes childless-ness easy to implement and avoids the complexity of the Node methods that deal with children. r NcdSr.r rs rr8zChildless._get_firstChildrrcdSr.r rs rr<zChildless._get_lastChildrrcPtj|jdz)Nz nodes cannot have childrenrDrErFrrRs rrJzChildless.appendChild'g)) M9 9;; ;rcdSrr rs rr1zChildless.hasChildNodesurcPtj|jdzNz nodes do not have childrenrrrSrTs rrBzChildless.insertBeforerrcPtj|jdzr)rDrErMrr_s rrIzChildless.removeChilds'g!! M9 9;; ;rcdSr.r rs rrgzChildless.normalizes rcPtj|jdzrrrrSr[s rr\zChildless.replaceChildrr)rrrr\rr EmptyNodeListr0rrr8r<rJr1rBrIrgr\r rrrrsIJJJI;;;;;;;;;   ;;;;;rrcveZdZejZdZdZdZdZ e ee Z dZ dZ e e e Zd dZd S) ProcessingInstructiontargetrcc"||_||_dSr.r)rrrcs rrzProcessingInstruction.__init__s  rc|jSr.rcrs r_get_nodeValuez$ProcessingInstruction._get_nodeValuerirc||_dSr.rrs r_set_nodeValuez$ProcessingInstruction._set_nodeValues  rc|jSr.rrs r _get_nodeNamez#ProcessingInstruction._get_nodeNamerrc||_dSr.rrs r _set_nodeNamez#ProcessingInstruction._set_nodeNames  rrc Z||d|jd|jd|dS)Nz)rrrcrr,r*rr+s rr'zProcessingInstruction.writexmls5 t{{{DIIIttLMMMMMrNr)rrrr rr%rrrrrrrrrr'r rrrrs/H"I 88Ix }55HNNNNNNrrcneZdZdZdZdZeZdZdZe eexZ Z dZ dZ dZd Zd Zd Zd S) CharacterData)_datarlrHrRrQcdx|_|_dx|_|_d|_t |dSr)rlrHrRrQrr rrs rrzCharacterData.__init__s@/33T_266t/  drc*t|jSr.)rrcrs rrzCharacterData._get_length49~~rc|jSr.rrs r _get_datazCharacterData._get_datarrc||_dSr.rrrcs r _set_datazCharacterData._set_data s  rcz|j}t|dkrd}nd}d|jjd|dd|dS)N z...rz)rcrrfr)rrc dotdotdots rrgzCharacterData.__repr__sOy t99r>>III N # # #T!B$ZZ< > >..""y) $ 2 ? )rcrLrrs rr'zComment.writexmlsI 49  DEE E  44@AAAAArNr) rrrr rr%rrr'r rrrrsJ HHBBBBBBrrc,eZdZdZejZdZddZdS) CDATASectionr z#cdata-sectionrc|jddkrtd|d|jzdS)Nz]]>rz$']]>' not allowed in a CDATA sectionz)rcfindrLrrs rr'zCDATASection.writexmlsJ 9>>% A % %CDD D % 122222rNr) rrrrr rr%rr'r rrrrs:I&HH333333rrcbeZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdS)ReadOnlySequentialNamedNodeMap_seqr c||_dSr.r)rseqs rrz'ReadOnlySequentialNamedNodeMap.__init__s  rc*t|jSr.rrrs rr]z&ReadOnlySequentialNamedNodeMap.__len__rrc*t|jSr.r rs rrz*ReadOnlySequentialNamedNodeMap._get_lengthrrc8|jD]}|j|kr|cSdSr.)rrrJs rrDz+ReadOnlySequentialNamedNodeMap.getNamedItems8  AzT!!"  rcN|jD]}|j|kr|j|kr|cSdSr.)rrrrNs rrGz-ReadOnlySequentialNamedNodeMap.getNamedItemNSs@  A~--!+2J2J  rct|tr |j|}n||}|t ||Sr.)rrArGrDr)r name_or_tuplerVs rr<z*ReadOnlySequentialNamedNodeMap.__getitem__sP mU + + 4&4& 6DD$$]33D <=)) ) rcP|dkrdS |j|S#t$rYdSwxYwr7)rrrs rrz#ReadOnlySequentialNamedNodeMap.itemsD 1994 9U# #   44 s  %%c@tjdNz"NamedNodeMap instance is read-onlyrDrErrCs rrLz.ReadOnlySequentialNamedNodeMap.removeNamedItemg.. 022 2rc@tjdr(r)rFs rrOz0ReadOnlySequentialNamedNodeMap.removeNamedItemNSr*rc@tjdr(r)rRs rr>z+ReadOnlySequentialNamedNodeMap.setNamedItemr*rc@tjdr(r)rRs rrSz-ReadOnlySequentialNamedNodeMap.setNamedItemNSr*rc|jgSr.rrs rrWz+ReadOnlySequentialNamedNodeMap.__getstate__s  {rc |d|_dSr7rrYs rr[z+ReadOnlySequentialNamedNodeMap.__setstate__s!H rN)r )rrrrrr]rrDrGr<rrLrOr>rSrWr[r rrrrsI  222222222222rrz&Number of entries in the NamedNodeMap.c(eZdZdZdZdZdZdZdS) Identifiedz@Mix-in class that supports the publicId and systemId attributes.publicIdsystemIdc"||_||_dSr.r2)rr3r4s r_identified_mixin_initz!Identified._identified_mixin_inits    rc|jSr.)r3rs r _get_publicIdzIdentified._get_publicId }rc|jSr.)r4rs r _get_systemIdzIdentified._get_systemIdr9rN)rrrr\rr6r8r;r rrr1r1 sLJJ&I!!!rr1cJeZdZejZdZdZdZdZ dZ dZ dZ dZ ddZdS) DocumentTypeNct|_t|_|rt|\}}||_|j|_dSr.)rentities notationsrrr)rrrrs rrzDocumentType.__init__$sJ688 799  " ( 7 7 FI!DI  rc|jSr.)internalSubsetrs r_get_internalSubsetz DocumentType._get_internalSubset, ""rc|jetd}|j|_|j|_tjjj}|r g|j_ g|j _ |j j D]X}t|j|j |j }|j j |||||Y|jj D]}t!|j|j |j |j}|j|_|j|_|j|_|jj ||||||||||SdSr.)rlr=rrrDrEUserDataHandler NODE_CLONEDr?rr@Notationr3r4rerEntity notationNameactualEncodingrrt)rrmclonerrKnotationeentitys rrnzDocumentType.cloneNode/s^   % &&EEJ!YEN/;I D&(#')$,FFA' AJ KKHO(//999--iHEEEE+DDA#AJ AJ$%N44F,-,@@@)), FFG )((( OOG $ $ $  =9< r9rc|jSr.) errorHandlerrs r_get_errorHandlerzDocument._get_errorHandlerAs   rc|jSr.)rrs r_get_standalonezDocument._get_standaloneDr5rc|jSr.)strictErrorCheckingrs r_get_strictErrorCheckingz!Document._get_strictErrorCheckingGs ''rc|jSr.r]rs rr^zDocument._get_versionJrrc|j|jvr>tjt |dt ||j|j||jtj kr3| rtjdt ||S)Nr>z two document elements disallowed) r%rCrDrErFrGrHrIr rf_get_documentElementrJrRs rrJzDocument.appendChildMs = 6 6 6'--.24jjjj$t***EGG G ? & O ' ' - - - =D- - -((** .'--244 4d+++rc |j|n,#t$rtjwxYwdx|_|_d|_|j |urd|_ |Sr.) r0r^rLrDrErMrQrRrHdocumentElementr_s rrIzDocument.removeChild]s ( O " "8 , , , , ( ( ('%%'' ' (:>>x7"  8 + +#'D r`cL|jD]}|jtjkr|cSdSr.)r0r%r rfrRs rrzDocument._get_documentElementis;O  D} 111 2  rc|j |jd|_t|dSr.)rurdr rs rrdzDocument.unlinkns= < # L   ! ! !DL Drc|sdS|jddd}|j|_|j|_|j|_|jD]f}t |||}|j||jtj krn|jtj kr||_ ||_ g|tjjj|||Sr.)rprwrrrtr0rkrer%r r&rSrurHrrDrErFrG)rrmrLrK childclones rrnzDocument.cloneNodets 4#224tDD?   * *A$Qe44J   # #J / / /"d&8888$(??? * $)J ! ! $$SW%<%H%)5 2 2 2 rc0t}||_|Sr.)rrl)rrs rcreateDocumentFragmentzDocument.createDocumentFragments   rc2t|}||_|Sr.)rmrl)rrrNs r createElementzDocument.createElements G  rct|tstdt}||_||_|SNznode contents must be a string)rr r?rrcrl)rrcts rcreateTextNodezDocument.createTextNodes?$$$ ><== = FFrct|tstdt}||_||_|Sr)rr r?rrcrlrrcrUs rcreateCDATASectionzDocument.createCDATASections?$$$ ><== = NNrc2t|}||_|Sr.)rrlrs r createCommentzDocument.createComments DMMrc4t||}||_|Sr.)rrl)rrrcps rcreateProcessingInstructionz$Document.createProcessingInstructions !&$ / /rc@t|}||_d|_|Sr)rrlr)rras rcreateAttributezDocument.createAttributes KKrcZt|\}}t|||}||_|Sr.)rrmrl)rrrrrrNs rrtzDocument.createElementNSs1$]33 M< 8 8rcjt|\}}t||||}||_d|_|Sr)rrrlr)rrrrrrs rcreateAttributeNSzDocument.createAttributeNSs:$]33  i @ @rc8t||||}||_|Sr.)rIrl)rrr3r4rJrNs r_create_entityzDocument._create_entitys! 48\ : :rc6t|||}||_|Sr.)rHrl)rrr3r4rKs r_create_notationzDocument._create_notations T8X . .rc||jvr |j|S|js |jsdS|j}||jg}||_n|sdSd}|rx|}|d|jD||}|r|j D]}|j rG| |j |j r&||j|j<|j|kr|}F|jsntP||jr'||j|j<|j|kr|}|jsn3|jr*||j|j<|j|kr|}|jdkrnnF|jr?|j D]%}|jr||j|j<|j|kr|}&|n|x|S)Nc.g|]}|jtv|Sr )r%rN).0ris r z+Document.getElementById..s2IIIE"^/GGG GGGrr?)rrrrrpopextendr0rrrrrrrrrrr)rr+stackresultrVrrvs rgetElementByIdzDocument.getElementByIdsN   >"% % 4#7 4% =)*E$)D ! ! 4& 99;;D LLIIT_III J J J&&t,,D *!O2244""D(";;t'8$.II&9=DN4:6#zR//)-%)%9& %49-- "59tz2:++%)FF!%!5"!E""59tz2:++%)FF!1Q66!E% * O2244**D{*59tz2:++%)F!M& N rc<t||tSr.rrCs rrzDocument.getElementsByTagNames.tT8::FFFrc>t|||tSr.rrFs rrzDocument.getElementsByTagNameNS rrc8|j||Sr.)rprqrrs rruzDocument.isSupporteds"--gw???rc|jtjkrtjd|jtjkrtjdt|||S)Nzcannot import document nodesz!cannot import document type nodes)r%r r&rDrENotSupportedErrrSrk)rrVrms r importNodezDocument.importNodesb =D. . .'))*HII I ]d5 5 5'))*MNN N4t,,,rrcg}|r|d|d||d|rdndd|dd|d||jD]}|||||dS) Nz encoding="rz standalone="yesnoz@@@ FI :, , ,nG"++A...G  % :* * *AIIAF"((+++2..q111 r)rrrNN)=rrrrr rfrrrSrCrhrpr&r%rrrrHrRrQrKrrrtrrrrrrrXrrr[rrrr^rJrIrrdrnrrrrrrrrtrrrrrrrurr'rr rrr|r| s@I*D,L*D,CE'&((N!HHIJJ$((Ok NHJGLKO%%%(((###   !!!(((,,,     *        888tGGG777@@@---KO  ; ; ; ; 33333rr|rz#Top-level element of this document.c |j|rtjjj}ntjjj}|jtj kr| |j |j }|j D]T}||j |j |j||j |j}|j|_U|r0|jD](}t+|||}||)n<|jtjkrH|}|r0|jD](}t+|||}||)n|jtjkr||j}n|jtjkr||j}n}|jtjkr"||j |j}nF|jtj!kr|"|j}n|jtj#kr5|$|j |j }d|_|j|_n|jtj%krtjjj}|j&'|j(|j)|j*}||_|r:g|j+_,g|j-_,|j-j,D]o} t]| j | j)| j*} || _|j-j,/| ta| dr| 1|| | p|j+j,D]} te| j | j)| j*| j3} | j4| _4| j5| _5| j6| _6|| _|j+j,/| ta| dr| 1|| | n/tj7dtq|zta|dr|1||||S)zo Clone a node and give it the new owner document. Called by Node.cloneNode and Document.importNode TrzCannot clone node %s)9rlr{rDrErFrG NODE_IMPORTEDr%r rfrtrrrrrrrrrr0rkrJr@rrbrrcrrrrrrrrrrSrpryrr3r4r?rr@rHrerrrIrJrKrrtrrG) rVrmnewOwnerDocumentrrLrvrrirUrKrMrNrOs rrkrkas6  $$%566:G+7 G+9  }))) 001B15@@O**,, ) )D  !2DM4: N N N(():DNKKA.AKK  % % %t-=>>!!!$$$$ $5 5 5 7799  % % %t-=>>!!!$$$$ $. ( ( // :: $1 1 1 33DI>> $: : : <3H==H  DAq*55a;; tt   ""rrr.)7r\r!rrDrrrrxml.dom.minicompatxml.dom.xmlbuilderrr rEr rfrrN defpropertyrYrrrrrrobjectr  AttributeListr`rrmrrrrrr rrrrr1r=rIrHrhr~rOr|rkrrrrrr rrrs" JJJJJJJJJJJJ >>>>>>>> GL5GL>@ttttt37<tttl D,$@AAAA D+$?@@@@ D+$HIIII%%%%%t%%%$y8y8y8y8y84y8y8y8v D&$FGGGG D+$MNNNN D,$EFFFFa?a?a?a?a?6a?a?a?F L(68888 v( 8D$  L"L"L"L"L"dL"L"L"\ G\<>>>> G[79999    &;&;&;&;&;&;&;&;RNNNNNItNNN4ECECECECECItECECECN M8)EFFFFS+S+S+S+S+=S+S+S+j D0.//// D+@BBBB B B B B Bm B B B 3 3 3 3 34 3 3 3<<<<<V<<<| *H8::::        ::::::y$:::x&9&9&9&9&9Z&9&9&9P88888z9d888MMMMM+MMM^(((((&(((T222QQQQQtZQQQf  H'57777OOOd!!!44445555######rPKN\-{.dom/__pycache__/__init__.cpython-311.opt-2.pycnu[ !A?h| GddZdZdZdZdZdZdZdZd Zd Z d Z d Z d Z dZ dZdZdZGddeZGddeZGddeZGddeZGddeZGddeZGddeZGd d!eZGd"d#eZGd$d%eZGd&d'eZGd(d)eZGd*d+eZGd,d-eZGd.d/eZ Gd0d1eZ!Gd2d3eZ"Gd4d5Z#d6Z$d7Z%d8Z&d9Z'd9Z(dd:l)m*Z*m+Z+d9S);cDeZdZ dZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdS)Node N)__name__ __module__ __qualname__ __slots__ ELEMENT_NODEATTRIBUTE_NODE TEXT_NODECDATA_SECTION_NODEENTITY_REFERENCE_NODE ENTITY_NODEPROCESSING_INSTRUCTION_NODE COMMENT_NODE DOCUMENT_NODEDOCUMENT_TYPE_NODEDOCUMENT_FRAGMENT_NODE NOTATION_NODEr=/opt/alt/python-internal/lib64/python3.11/xml/dom/__init__.pyrrsY.I#$L"#N"#I"#"#"#K"#"#L"#M"$"$"$MMMr!rrrrrr r r r r rrr ceZdZ dZdZdS) DOMExceptioncj|jturtdtj|g|Ri|dS)Nz0DOMException should not be instantiated directly) __class__r( RuntimeError Exception__init__)selfargskws r"r-zDOMException.__init__BsN >\ ) )BDD D4-$---"-----r!c|jS)N)code)r.s r" _get_codezDOMException._get_codeHs yr!N)rrrr-r3rr!r"r(r(>s8I... r!r(ceZdZeZdS) IndexSizeErrN)rrrINDEX_SIZE_ERRr2rr!r"r5r5L DDDr!r5ceZdZeZdS)DomstringSizeErrN)rrrDOMSTRING_SIZE_ERRr2rr!r"r9r9O DDDr!r9ceZdZeZdS)HierarchyRequestErrN)rrrHIERARCHY_REQUEST_ERRr2rr!r"r=r=R DDDr!r=ceZdZeZdS)WrongDocumentErrN)rrrWRONG_DOCUMENT_ERRr2rr!r"rArAUr;r!rAceZdZeZdS)InvalidCharacterErrN)rrrINVALID_CHARACTER_ERRr2rr!r"rDrDXr?r!rDceZdZeZdS)NoDataAllowedErrN)rrrNO_DATA_ALLOWED_ERRr2rr!r"rGrG[ DDDr!rGceZdZeZdS)NoModificationAllowedErrN)rrrNO_MODIFICATION_ALLOWED_ERRr2rr!r"rKrK^s &DDDr!rKceZdZeZdS) NotFoundErrN)rrr NOT_FOUND_ERRr2rr!r"rNrNa DDDr!rNceZdZeZdS)NotSupportedErrN)rrrNOT_SUPPORTED_ERRr2rr!r"rRrRd DDDr!rRceZdZeZdS)InuseAttributeErrN)rrrINUSE_ATTRIBUTE_ERRr2rr!r"rVrVgrIr!rVceZdZeZdS)InvalidStateErrN)rrrINVALID_STATE_ERRr2rr!r"rYrYjrTr!rYceZdZeZdS) SyntaxErrN)rrr SYNTAX_ERRr2rr!r"r\r\ms DDDr!r\ceZdZeZdS)InvalidModificationErrN)rrrINVALID_MODIFICATION_ERRr2rr!r"r_r_ps #DDDr!r_ceZdZeZdS) NamespaceErrN)rrr NAMESPACE_ERRr2rr!r"rbrbsrPr!rbceZdZeZdS)InvalidAccessErrN)rrrINVALID_ACCESS_ERRr2rr!r"rerevr;r!receZdZeZdS) ValidationErrN)rrrVALIDATION_ERRr2rr!r"rhrhyr7r!rhc eZdZ dZdZdZdZdS)UserDataHandlerrrrrN)rrr NODE_CLONED NODE_IMPORTED NODE_DELETED NODE_RENAMEDrr!r"rkrk|s'LKMLLLLr!rkz$http://www.w3.org/XML/1998/namespacezhttp://www.w3.org/2000/xmlns/zhttp://www.w3.org/1999/xhtmlN)getDOMImplementationregisterDOMImplementation),rr6r:r>rBrErHrLrOrSrWrZr]r`rcrfrir,r(r5r9r=rArDrGrKrNrRrVrYr\r_rbrerhrk XML_NAMESPACEXMLNS_NAMESPACEXHTML_NAMESPACEEMPTY_NAMESPACE EMPTY_PREFIXdomregrprqrr!r"rxs"%%%%%%%%4"#!"!"!"!"!"!"!" !"!#!#!# !#!# !#!#     9   <|!!!!!,!!!|!!!!!,!!!|'''''|''',l l $$$$$\$$$<|L7 10 CCCCCCCCCCr!PKN\+SiEE-dom/__pycache__/pulldom.cpython-311.opt-2.pycnu[ !A?hu-ddlZddlZdZdZdZdZdZdZdZ d Z Gd d ej j Z Gd d ZGddZGdde ZdZddZddZdS)N START_ELEMENT END_ELEMENTCOMMENTSTART_DOCUMENT END_DOCUMENTPROCESSING_INSTRUCTIONIGNORABLE_WHITESPACE CHARACTERSc~eZdZdZdZddZdZdZdZdZ dZ dZ d Z d Z d Zd Zd ZdZdZdZdZdZdS)PullDOMNcddlm}||_ddg|_|j|_g|_|jj|_ |jj|_n#t$rYnwxYw|dig|_ |j d|_ g|_ dS)Nr) XML_NAMESPACExml) xml.domrdocumentFactory firstEvent lastEvent elementStackappendpushpopAttributeError _ns_contexts_current_contextpending_events)selfrrs >>%+^tc"""r#cB|j|_dSr%)rrr)rr.s rendPrefixMappingzPullDOM.endPrefixMapping0s $ 1 5 5 7 7r#cd}t|dd}||D]\}}||j||f<g|_|\}} |rV||j|} | r | dz| z}n| }|jr|j||} nO|||} n8|jr|j| } n|d| } |D]\}}|\} } | |kr?| dkr| }nd| z}|j | |}| |n|| rK|j| } | r | dz| z}n| }|j | |}| |n/|j | }| |||_ t| fdg|jd<|jd|_|| dS)Nzhttp://www.w3.org/2000/xmlns/r*:r+zxmlns:)getattr_attrsr*rdocumentcreateElementNS buildDocument createElementitemscreateAttributeNSsetAttributeNodeNScreateAttributesetAttributeNodevaluerrr)rnametagNameattrs xmlns_uri xmlns_attrsanamerAr/ localnamer.nodea_uri a_localnameqnameattrs rstartElementNSzPullDOM.startElementNS3sD3 dND99  " + 9 9 u38 i/00 "D Y  ;.s3($slY6GG'G} 8}44S'BB))#w77} ;}229==))$ :: ;;==  KE%!& E; !!'))'EE${2E}66ueDD''---- ,.u5("SL;6EE'E}66ueDD''----}44[AA%%d+++DJJ+T2D9q* $r#ctt|fdg|jd<|jd|_dSNr5rrr)rrBrCs r endElementNSzPullDOM.endElementNSl2)488::6=q*r#c|jr|j|}n|d|}|D];\}}|j|}||_||sc!"C(("&--! '$$&& &&' 2 22r#cddlm}t|}||}|stj}t |||S)Nr)StringIO)iorlenrrrr)stringrrrrs r parseStringrIs[&kkG (6  C '$$&& #vw / //r#)NNr%)xml.saxrxml.sax.handlerrrrrrrr r rContentHandlerr rrrrrrrr#rrs9  ! 1-  uuuuucg$uuunMMMMMMMM^%%%%%g%%%B! 3 3 3 3000000r#PKN\3W330dom/__pycache__/NodeFilter.cpython-311.opt-2.pycnu[ !A?h GddZdS)cVeZdZ dZdZdZdZdZdZdZ dZ dZ dZ d Z d Zd Zd Zd ZdZdZdS) NodeFilterl @iiict)N)NotImplementedError)selfnodes ?/opt/alt/python-internal/lib64/python3.11/xml/dom/NodeFilter.py acceptNodezNodeFilter.acceptNodes!!N)__name__ __module__ __qualname__ FILTER_ACCEPT FILTER_REJECT FILTER_SKIPSHOW_ALL SHOW_ELEMENTSHOW_ATTRIBUTE SHOW_TEXTSHOW_CDATA_SECTIONSHOW_ENTITY_REFERENCE SHOW_ENTITYSHOW_PROCESSING_INSTRUCTION SHOW_COMMENT SHOW_DOCUMENTSHOW_DOCUMENT_TYPESHOW_DOCUMENT_FRAGMENT SHOW_NOTATIONrrrrrsMMK",H",L",N",I",",",K",",L",M",",",M"""""rrN)rr(rrr)s7""""""""""rPKN\BΩΩ2dom/__pycache__/expatbuilder.cpython-311.opt-2.pycnu[ !A?h  ddlmZmZmZddlmZmZmZddlmZddl m Z m Z ddl m Z ejZejZejZejjZejjZejjZejjZejZejddejddejdd ejdd ejdd ejdd ejdd ejddejddd ZGddeZdZdZGddZeeefZGddeZ GddeZ!Gdde!Z"Gdde!Z#dZ$d e$zZ%Gd!d"eZ&Gd#d$Z'Gd%d&e'eZ(Gd'd(e'e&Z)Gd)d*e*Z+Gd+d,eZ,d3d.Z-d3d/Z.d3d0Z/d3d1Z0d2Z1dS)4) xmlbuilderminidomNode)EMPTY_NAMESPACE EMPTY_PREFIXXMLNS_NAMESPACE)expat) _append_child_set_attribute_node) NodeFilterNcdata enumerationentityentitiesididrefidrefsnmtokennmtokens) CDATAENUMENTITYENTITIESIDIDREFIDREFSNMTOKENNMTOKENScJeZdZdZd dZdZdZdZdZdZ d Z d Z d Z dS) ElementInfo _attr_info_modeltagNameNc0||_g|_||_dSN)r$r"r#)selfr$models A/opt/alt/python-internal/lib64/python3.11/xml/dom/expatbuilder.py__init__zElementInfo.__init__?s  c*|j|j|jfSr&r!r's r) __getstate__zElementInfo.__getstate__Ds T\99r+c0|\|_|_|_dSr&r!)r'states r) __setstate__zElementInfo.__setstate__Gs5:2dlllr+c|jD]F}|d|kr8|d}|ddkrtdcSt|dcSGtjS)Nr(r)r" _typeinfo_mapr_no_type)r'anameinfots r)getAttributeTypezElementInfo.getAttributeTypeJsnO 3 3DAw%HQ43;;(0000(b2222  r+ctjSr&)rr7)r' namespaceURI localNames r)getAttributeTypeNSzElementInfo.getAttributeTypeNSTs r+cv|jr1|jd}|tjjtjjfvSdSNrF)r#r r( XML_CTYPE_ANYXML_CTYPE_MIXED)r'types r)isElementContentzElementInfo.isElementContentWs? ; ;q>D 9 % ; == =5r+cT|jr |jdtjjkSdSrA)r#r r(XML_CTYPE_EMPTYr-s r)isEmptyzElementInfo.isEmpty_s' ; ;q>U[%@@ @5r+cN|jD]}|d|kr|ddkcSdS)Nr3r4rF)r")r'r8r9s r)isIdzElementInfo.isIdesAO ( (DAw%Bx4'''' ur+c0|||fSr&)rJ)r'eurienameaurir8s r)isIdNSzElementInfo.isIdNSksyy$'''r+r&) __name__ __module__ __qualname__ __slots__r*r.r1r;r?rErHrJrOr+r)r r <s1I :::;;;        (((((r+r c.|||Sr&)_intern_setdefault)builderss r)_internrYos  % %a + ++r+cd|d}|j}t|dkr2|\}}}|||}|d|}|||}|||}n@t|dkr|\}}t}|||x}}nt d|z||||||fS)N :z4Unsupported syntax: spaces in URIs not supported: %r)splitrVlenr ValueError)rWnamepartsinternuri localnameprefixqnames r)_parse_ns_namerirs JJsOOE  'F 5zzQ!&Y''!6699-ue$$F9i00 UqY"F9i888 ORVVWWW 6#s  Y 55r+ceZdZ ddZdZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdS) ExpatBuilderNc|tj}||_|jjt |jj|_nd|_t |_d|_| dSr&) rOptions_optionsfilterFilterVisibilityController_filterr_finish_start_element_parserreset)r'optionss r)r*zExpatBuilder.__init__sf ? (**G =  +5dm6JKKDLLDL*,D &  r+c* tjSr&)r ParserCreater-s r) createParserzExpatBuilder.createParsers)!###r+c |jsm||_|jjj|_d|j_d|j_d|j_||j|jSNT) rsrxrd setdefaultrV buffer_textordered_attributesspecified_attributesinstallr-s r) getParserzExpatBuilder.getParserslE| ',,..DL&*l&9&DD #'+DL $.2DL +04DL - LL & & &|r+c ttdd|_|j|_|jj|_d|_dSNF)theDOMImplementationcreateDocumentrdocumentcurNode _elem_info_cdatar-s r)rtzExpatBuilder.resetsCD,;; T4)) } -2 r+c |j|_|j|_|j|_|j|_|jj r |j |_ |j |_ |jjr |j|_|jjr%|j|_|j|_|j|_n |j|_|j|_|j|_|j|_|j|_ dSr&)!start_doctype_decl_handlerStartDoctypeDeclHandlerfirst_element_handlerStartElementHandlerend_element_handlerEndElementHandler pi_handlerProcessingInstructionHandlerrnrentity_decl_handlerEntityDeclHandlernotation_decl_handlerNotationDeclHandlercommentscomment_handlerCommentHandlercdata_sectionsstart_cdata_section_handlerStartCdataSectionHandlerend_cdata_section_handlerEndCdataSectionHandlercharacter_data_handler_cdataCharacterDataHandlercharacter_data_handlerexternal_entity_ref_handlerExternalEntityRefHandlerxml_decl_handlerXmlDeclHandlerelement_decl_handlerElementDeclHandlerattlist_decl_handlerAttlistDeclHandlerr'parsers r)rzExpatBuilder.installsL)-)H&%)%?"#'#; .2o+ = ! @'+'?F $%)%?" = ! 9$($8F ! = ' F.2.NF +,0,JF )*.*KF ' '*.*EF '*.*J' $ 5$($=!$($=!!!r+cr |}d} |d}|sn<||d|r!|jjr||d}T|ddn#t $rYnwxYw|j}|d|_|S)NTr3i@Fr+) rreadParserdocumentElement _setup_subset ParseEscapertrs)r'filer first_bufferbufferdocs r) parseFilezExpatBuilder.parseFiles !!   %7++ VU+++/DM$A/&&v...$  % LLd # # # #    D m   sA+B BBc |} ||d||n#t$rYnwxYw|j}|d|_|Srz)rrrrrrtrs)r'stringrrs r) parseStringzExpatBuilder.parseStringsJ!!  LL & & &   v & & & &    D m   s+A AAc |jjrJt}|||}||jj_dSdSr&)rdoctypeInternalSubsetExtractorr getSubsetinternalSubset)r'r extractorsubsets r)rzExpatBuilder._setup_subsets_= =  :/11I  ! !& ) ) )((**F39DM ! 0 0 0  : :r+c|jj|||}|j|_t |j|||j_|jrV|j|tkr3d|j_|jj d=d}d|j _ d|j _ |rE|g|j _g|j_d|j _d|j _|j|j _dSdSN)rimplementationcreateDocumentType ownerDocumentr rrq acceptNode FILTER_REJECT childNodesrsrrr_seq notationsrrend_doctype_decl_handlerEndDoctypeDeclHandler)r' doctypeNamesystemIdpublicIdhas_internal_subsetrs r)rz'ExpatBuilder.start_doctype_decl_handlers-.AA 8-- $ dmW--- '  < 4DL33G<< MM$(DM ! (,G-1DL */3DL ,  O"(* %)+!&*.DL '8
DL '48O 1 *4< *')D $ $ $ * * * *r+c|j||}t|j||jr?|j|t kr|j|dSdSdSr&)rcreateProcessingInstructionr rrqrr removeChild)r'targetdatanodes r)rzExpatBuilder.pi_handler s{}88FFdlD))) < +DL33D99]JJ L $ $T * * * * * + +JJr+c|jj}|jr\|jr3|djt kr|d|dS|j|}d|_nY|r1|djtkr|d}|j |z}||_ dStj }||_ |j|_ t|j|dS)NrT)rrr_cdata_continuenodeTypeCDATA_SECTION_NODE appendDatarcreateCDATASection TEXT_NODErrTextrr )r'rrrvalues r)rz)ExpatBuilder.character_data_handler_cdatas\, ; /&  n-1CCC2))$///=33D99D#'D  /JrN3y@@b>DI$EDI F<>>DDI!%D dlD)))))r+c|jj}|r/|djtkr|d}|j|z|_dSt j}|j|z|_|j|_t|j|dSr) rrrrrrrrrr )r'rrrs r)rz#ExpatBuilder.character_data_handler&s|\,  *R.1Y>>b>D D(DI F|~~I$ !]dlD)))))r+c|rdS|jjsdS|j||||}|4|j|} |j| |jjjj||j r<|j |tkr|jjjjd=dSdSdSr) rnrr_create_entitycreateTextNoderappendrrrqrr) r' entityNameis_parameter_entityrbaserr notationNamerchilds r)rz ExpatBuilder.entity_decl_handler1s   F}%  F}++J,4lDD  M0077E O " "5 ) ) ) &+224888 < 8DL33D99]JJ %.3B777 8 8JJr+c|j|||}|jjjj||jr<|j|tkr|jjjjd=dSdSdSr) r_create_notationrrrrrqr FILTER_ACCEPT)r'rrrrrs r)rz"ExpatBuilder.notation_decl_handlerCs}--lHhOO ',33D999 < 9DL33D99]JJ %/4R888 9 9JJr+c|j|}t|j||jr?|j|t kr|j|dSdSdSr&)r createCommentr rrqrrr)r'rrs r)rzExpatBuilder.comment_handlerIsy}**400dlD))) < +DL33D99]JJ L $ $T * * * * * + +JJr+c"d|_d|_dS)NTFrrr-s r)rz(ExpatBuilder.start_cdata_section_handlerOs $r+c"d|_d|_dSrrr-s r)rz&ExpatBuilder.end_cdata_section_handlerSs $r+cdSNr3rT)r'contextrrrs r)rz(ExpatBuilder.external_entity_ref_handlerWsqr+c|j|js t|_|j|_|||dSr&)rqrrrstart_element_handlerrr)r'rb attributess r)rz"ExpatBuilder.first_element_handlerZsJ <  ')D $/3/I, ""444444r+c|j|}t|j|||_|rvt dt |dD]W}t j||tdt}||dz}||_ |j|_ t||X||jj ur||dSdS)Nrr^r3)r createElementr rranger`rAttrrrrrr rrr)r'rbrriars r)rz"ExpatBuilder.start_element_handler`s}**400dlD)))  -1c*ooq11 - -LA!%|55"1Q3"&-#D!,,,, t}4 4 4  & &t , , , , , 5 4r+cP|jr||jjurdS|j|}|tkrt |n|t krt|ndS|j|_ |j || dSdSr&) rqrrstartContainerrRejecter FILTER_SKIPSkipper parentNoderrunlink)r'rfilts r)rrz"ExpatBuilder._finish_start_elementqs < t}444<..t44D}$$$$ ?DL O ' ' - - - KKMMMMM#  r+cV|j}|j|_||dSr&)rrr)r'rbrs r)rz ExpatBuilder.end_element_handlers-,)    )))))r+cL|j|j}|r||||jrc||jjurdS|j|tkr2|j || dSdSdSr&) rgetr$_handle_white_text_nodesrqrrrrrrr)r'rr9s r)rz ExpatBuilder._finish_end_elements""7?33  9  ) )'4 8 8 8 < !$-777|&&w//=@@ ((111      ! !A@r+c|jjs|sdSg}|jD]@}|jt kr.|js||A|D]}| |dSr&) rnwhitespace_in_element_contentrErrrrstriprr)r'rr9Lrs r)r z%ExpatBuilder._handle_white_text_nodess M 7 ((**  F _  E~**5:3C3C3E3E* $ $E   U # # # # $ $r+c|j|}|t|||j|<dS||_dSr&)rr r r#)r'rbr(r9s r)rz!ExpatBuilder.element_decl_handlersE""4(( <$/e$<$>>.,   :::OOO****+++ ***( * * *888$999 +++ %%%%%%555 ---".*** ! ! !$$$"   BBB11111r+rkcJeZdZ dZdZdZdZeje j ej e j ej e jeje jeje jeje jeje jeje jeje jeje jeje jeje j i Z!dS)rproc||_dSr&r)r'ros r)r*z#FilterVisibilityController.__init__s  r+c|j|j}|jj|zrV|j|}|t krt |tvrtdt|z|StS)Nz)startContainer() returned illegal value: ) _nodetype_maskrro whatToShowrFILTER_INTERRUPTr_ALLOWED_FILTER_RETURNSrareprr)r'rmaskvals r)rz)FilterVisibilityController.startContainers"4=1 ; !D ( !+,,T22C&&&!!111 ADIIMOOOJ r+c~|j|j}|jj|zr|j|}|t krt |tkr5|j}|j ddD]}| |tS|tvrtdt|z|StS)Nz%acceptNode() returned illegal value: )rrrorrr rrrr appendChildrr!rar"r)r'rr#r$parentrs r)rz%FilterVisibilityController.acceptNodes"4=1 ; !D ( !+((..C&&&!!k!!!_QQQ/..E&&u----$$111 =S IKKKJ r+N)"rPrQrRrSr*rrr ELEMENT_NODEr SHOW_ELEMENTATTRIBUTE_NODESHOW_ATTRIBUTEr SHOW_TEXTrSHOW_CDATA_SECTIONENTITY_REFERENCE_NODESHOW_ENTITY_REFERENCE ENTITY_NODE SHOW_ENTITYPROCESSING_INSTRUCTION_NODESHOW_PROCESSING_INSTRUCTION COMMENT_NODE SHOW_COMMENT DOCUMENT_NODE SHOW_DOCUMENTDOCUMENT_TYPE_NODESHOW_DOCUMENT_TYPEDOCUMENT_FRAGMENT_NODESHOW_DOCUMENT_FRAGMENT NOTATION_NODE SHOW_NOTATIONrrTr+r)rprps5I ! ! !!!!* **A **C **> **G "**J **@ (**P **A **B **G #**K **B  NNNr+rpceZdZdZdZdS) FilterCrutch)_builder_level _old_start_old_endcd|_||_|j}|j|_|j|_|j|_|j|_dSr) rAr@rsrrBrrCrr)r'rWrs r)r*zFilterCrutch.__init__sG   40 %)%?"#'#;   r+N)rPrQrRrSr*rTr+r)r?r?s(>I<<<< %%s ]> &fragment-builder-internal;c<eZdZ d dZdZdZdZdZdZdZ dS) FragmentBuilderNc|jtkr||_||_n|j|_||_t ||dSr&)rr6originalDocumentrrrkr*)r'rrus r)r*zFragmentBuilder.__init__[sO  } , ,$+D !"DLL$+$9D !"DLdG,,,,,r+cHt|d|_dSr&)rkrtfragmentr-s r)rtzFragmentBuilder.resetds!4    r+cR ||Sr&)rrr'rs r)rzFragmentBuilder.parseFilehs#  ,,,r+c ||_|}|jj}d}|rH|jp|}|jrd|jd|jd}n|jr d|jz}nd}|}t|||fz} | |dn#| xYw|j }| |S)NzPUBLIC "z" ""z SYSTEM "%s"T) _sourcerrSrr_getDeclarationsrr _getNSattrs_FRAGMENT_BUILDER_TEMPLATErrtrU) r'rrridentrnsattrsrrUs r)rzFragmentBuilder.parseStringms   !!'/  +Ft/D/D/F/FF 9 9#,,,g.>.>.>@! 9%(88F""$$-0HH  LL4 ( ( ( (  JJLLL = s B00Ccd |jjj}d}|rt|jjD]Y}|j|}|r|dz}|d|j}|jr|d|jd|j d}L|d|j d}Zt|j jD]}|j |}|r|dz}|d|j}|jr|d|jd|j d }n'|j r|d|j d }n|d |j j d }|j r |d |j }|d z}|S) NrYz z z SYSTEM "z )rrrrrlengthitemnodeNamerrr firstChildrr)r'rrXrnotationrs r)r\z FragmentBuilder._getDeclarationss ,,4   7,344 C C",11!44#F A)*H,=,=>$C11h///1B1B1BDAA./QQ0A0A0ABAA7+233   )..q11#F A'(qq&//:?@11fooov@AA_@,-AAv?AA%&QQ(9(>(>(>?A&D,-AAv/B/BCAGr+cdS)NrYrTr-s r)r]zFragmentBuilder._getNSattrssrr+c|tkr|j}|j}|j|}|j|_|j|_|j|_ ||j d||_||_d|_ n#||_||_d|_ wxYwdSt |||||S)NTr) $_FRAGMENT_BUILDER_INTERNAL_SYSTEM_IDrrrsExternalEntityParserCreaterScreateDocumentFragmentrUrr[rkr)r'rrrr old_document old_cur_noders r)rz+FragmentBuilder.external_entity_ref_handlers ; ; ; =LtT0J0J-Y#-DL  $ $W - - - - -r+N) rPrQrRrsrxrryrrrTr+r)rprpscA'''  333888-&-&-&^..r+rpceZdZ dZdS)ExpatBuilderNScbt||dSr&)rkrtrsr-s r)rtzExpatBuilderNS.reset)s.4    r+N)rPrQrRrtrTr+r)rr&s&4r+rceZdZ dZdZdS)FragmentBuilderNScbt||dSr&)rQrtrsr-s r)rtzFragmentBuilderNS.reset1s.d### r+c d}|j}g}|rst|drZ|jD]@\}}||vr |||rd|z}nd}|r |d|d|d}7d|d|d}A|j}|s|S) NrY_ns_prefix_urir}r~z z=''r[)rhasattrritemsrr)r'attrsrrrgredeclnames r)r]zFragmentBuilderNS._getNSattrs5s ,  )w 011 =#*#9#?#?#A#A = =KFC{{ HHV$$$+#+f#4#*=5:UUHHHccc J=/7hh <(G )  r+N)rPrQrRrtr]rTr+r)rr.s54r+rceZdZ dS)rN)rPrQrRrTr+r)rrSsODr+rc>eZdZ dZdZdZdZdZdZdZ dZ dS) rNc |jSr&)rr-s r)rz!InternalSubsetExtractor.getSubset\s 5{r+c` t||dS#t$rYdSwxYwr&)rkrrrWs r)rz!InternalSubsetExtractor.parseFile`sE   " "4 . . . . .    DD   --c` t||dS#t$rYdSwxYwr&)rkrr)r'rs r)rz#InternalSubsetExtractor.parseStringfsE   $ $T6 2 2 2 2 2    DD rc6|j|_|j|_dSr&)rrrrrs r)rzInternalSubsetExtractor.installls)-)H&%)%?"""r+c|r:|}g|_|jj|_|j|_dSt r&)rrrDefaultHandlerrrr)r'rbrrrrs r)rz2InternalSubsetExtractor.start_doctype_decl_handlerpsH  ^^%%FDK$(K$6F !+/+HF ( ( (-- r+cd|jdddd}||_t)NrYz   )joinrreplacer)r'rXs r)rz0InternalSubsetExtractor.end_doctype_decl_handlerzsF GGDK ( ( 6 6 > >tT J J mmr+ctr&)r)r'rbrs r)rz-InternalSubsetExtractor.start_element_handlers mmr+) rPrQrRrrrrrrrrrTr+r)rrWsL F  @@@    r+rTc |rt}nt}t|tr>t |d5}||}dddn #1swxYwYn||}|SNrb)rrk isinstancestropenr)r namespacesrWfpresults r)parsers! ""..$) $   +&&r**F + + + + + + + + + + + + + + +""4(( MsA((A,/A,cl |rt}nt}||Sr&)rrkr)rrrWs r)rrs;! ""..   v & &&r+c |rt|}nt|}t|tr>t |d5}||}dddn #1swxYwYn||}|Sr)rrQrrrr)rrrrWrrs r) parseFragmentrs +#G,,!'**$) $   +&&r**F + + + + + + + + + + + + + + +""4(( MsA**A.1A.cp |rt|}nt|}||Sr&)rrQr)rrrrWs r)parseFragmentStringrsA+#G,,!'**   v & &&r+cN |jrt|St|Sr&)rrrk)rus r) makeBuilderrs,6%g&&&G$$$r+)T)2xml.domrrrrrr xml.parsersr xml.dom.minidomr r xml.dom.NodeFilterr rrr6DOMBuilderFilterrrrr getDOMImplementationrTypeInfor6objectr rYrirkr!rpr?rrrjr^rQrprr ExceptionrrrrrrrrTr+r)rsU:.---------BBBBBBBBBB>>>>>>>>)))))) N ," +9 +9 )5 .?3w355! w//  }55  x00  z22  t,,  w//  x00  y11  z22   1(1(1(1(1(&1(1(1(f,,,666&|1|1|1|1|1|1|1|1B )-E7 7 7 7 7 7 7 7 t < < < < <6 < < <*****|***8!!!!!l!!!2?%*+ +r9r9r9r9r9lr9r9r9j\.\.\.\.\.\.\.\.~Z""""" O"""J     )   )))))l)))X$''''( ' ' ' '%%%%%r+PKN\d^0"&dom/__pycache__/domreg.cpython-311.pycnu[ !A?h{ :dZddlZdddZiZdZdZd d Zd ZdS) zRegistration facilities for DOM. This module should not be used directly. Instead, the functions getDOMImplementation and registerDOMImplementation should be imported from xml.dom.Nzxml.dom.minidomzxml.dom.DOMImplementation)minidom4DOMc|t|<dS)aIregisterDOMImplementation(name, factory) Register the factory function with the name. The factory function should return an object which implements the DOMImplementation interface. The factory function can either return the same object, or a new one (e.g. if that implementation supports some customization).N) registered)namefactorys ;/opt/alt/python-internal/lib64/python3.11/xml/dom/domreg.pyregisterDOMImplementationr sJtcH|D]\}}|||sdSdS)zF_good_enough(dom, features) -> Return 1 if the dom offers the featuresr) hasFeature)domfeaturesfvs r _good_enoughr s<!~~a"" 11  1r cddl}d}t|}|r't|iidg}|S|rt |St jjs$d|j vrt |j dSt|trt|}t D] }|}t||r|cS!tD]8} t |}n#t $rY wxYwt||r|cS9t#d)aSgetDOMImplementation(name = None, features = ()) -> DOM implementation. Return a suitable DOM implementation. The name is either well-known, the module name of a DOM implementation, or None. If it is not None, imports the corresponding module and returns DOMImplementation object if the import succeeds. If name is not given, consider the available implementations to find one with the required feature set. If no implementation can be found, raise an ImportError. The features list must be a sequence of (feature, version) pairs which are passed to hasFeature.rNgetDOMImplementation PYTHON_DOM)rz$no suitable DOM implementation found)oswell_known_implementationsget __import__rrsysflagsignore_environmentenviron isinstancestr_parse_feature_stringvaluesrkeys Exception ImportError)rrrcreatormodrs r rr'sIIIG $ ( ( . .C Eb"'=&>??''))) E$!!! Y )Elbj.H.H#2:l+CDDDD(C  3(22$$&&gii X & & JJJ .2244 &g666CC    H  X & & JJJ  < = ==sD  D-,D-cHg}|}d}t|}||krg||}|ddvrtd||dz}d}||kr||}|ddvr|dz}|}|||f||kgt |S)Nr 0123456789zbad feature name: r )splitlen ValueErrorappendtuple)srpartsilengthfeatureversionrs r r"r"RsH GGIIE A ZZF f**( 1: % %*ww@AA A E v::aAt|##E'*+++ f** ??r )Nr)__doc__rrrr rrr"rr r r7s>>  '       )>)>)>)>Vr PKN\X,dom/__pycache__/expatbuilder.cpython-311.pycnu[ !A?h dZddlmZmZmZddlmZmZmZddlm Z ddl m Z m Z ddl mZejZejZejZejjZejjZejjZejjZejZejddejdd ejdd ejdd ejdd ejdd ejddejddejddd ZGddeZdZdZGddZeeefZ GddeZ!GddeZ"Gdde"Z#Gdde"Z$d Z%d!e%zZ&Gd"d#eZ'Gd$d%Z(Gd&d'e(eZ)Gd(d)e(e'Z*Gd*d+e+Z,Gd,d-eZ-d4d/Z.d4d0Z/d4d1Z0d4d2Z1d3Z2dS)5zFacility to use the Expat parser to load a minidom instance from a string or file. This avoids all the overhead of SAX and pulldom to gain performance. ) xmlbuilderminidomNode)EMPTY_NAMESPACE EMPTY_PREFIXXMLNS_NAMESPACE)expat) _append_child_set_attribute_node) NodeFilterNcdata enumerationentityentitiesididrefidrefsnmtokennmtokens) CDATAENUMENTITYENTITIESIDIDREFIDREFSNMTOKENNMTOKENScJeZdZdZd dZdZdZdZdZdZ d Z d Z d Z dS) ElementInfo _attr_info_modeltagNameNc0||_g|_||_dSN)r$r"r#)selfr$models A/opt/alt/python-internal/lib64/python3.11/xml/dom/expatbuilder.py__init__zElementInfo.__init__?s  c*|j|j|jfSr&r!r's r) __getstate__zElementInfo.__getstate__Ds T\99r+c0|\|_|_|_dSr&r!)r'states r) __setstate__zElementInfo.__setstate__Gs5:2dlllr+c|jD]F}|d|kr8|d}|ddkrtdcSt|dcSGtjS)Nr(r)r" _typeinfo_mapr_no_type)r'anameinfots r)getAttributeTypezElementInfo.getAttributeTypeJsnO 3 3DAw%HQ43;;(0000(b2222  r+ctjSr&)rr7)r' namespaceURI localNames r)getAttributeTypeNSzElementInfo.getAttributeTypeNSTs r+cv|jr1|jd}|tjjtjjfvSdSNrF)r#r r( XML_CTYPE_ANYXML_CTYPE_MIXED)r'types r)isElementContentzElementInfo.isElementContentWs? ; ;q>D 9 % ; == =5r+cT|jr |jdtjjkSdSrA)r#r r(XML_CTYPE_EMPTYr-s r)isEmptyzElementInfo.isEmpty_s' ; ;q>U[%@@ @5r+cN|jD]}|d|kr|ddkcSdS)Nr3r4rF)r")r'r8r9s r)isIdzElementInfo.isIdesAO ( (DAw%Bx4'''' ur+c0|||fSr&)rJ)r'eurienameaurir8s r)isIdNSzElementInfo.isIdNSksyy$'''r+r&) __name__ __module__ __qualname__ __slots__r*r.r1r;r?rErHrJrOr+r)r r <s1I :::;;;        (((((r+r c.|||Sr&)_intern_setdefault)builderss r)_internrYos  % %a + ++r+cpd|vsJ|d}|j}t|dkr2|\}}}|||}|d|}|||}|||}n@t|dkr|\}}t}|||x}}nt d|z||||||fS)N :z4Unsupported syntax: spaces in URIs not supported: %r)splitrVlenr ValueError)rWnamepartsinternuri localnameprefixqnames r)_parse_ns_namerirs $;;;; JJsOOE  'F 5zzQ!&Y''!6699-ue$$F9i00 UqY"F9i888 ORVVWWW 6#s  Y 55r+ceZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdS) ExpatBuilderzPDocument builder that uses Expat to build a ParsedXML.DOM document instance.Nc|tj}||_|jjt |jj|_nd|_t |_d|_| dSr&) rOptions_optionsfilterFilterVisibilityController_filterr_finish_start_element_parserreset)r'optionss r)r*zExpatBuilder.__init__sf ? (**G =  +5dm6JKKDLLDL*,D &  r+c(tjS)zCreate a new parser object.)r ParserCreater-s r) createParserzExpatBuilder.createParsers!###r+c|jsm||_|jjj|_d|j_d|j_d|j_||j|jS)z7Return the parser object, creating a new one if needed.T) rsrxrd setdefaultrV buffer_textordered_attributesspecified_attributesinstallr-s r) getParserzExpatBuilder.getParsersi| ',,..DL&*l&9&DD #'+DL $.2DL +04DL - LL & & &|r+cttdd|_|j|_|jj|_d|_dS)z6Free all data structures used during DOM construction.NF)theDOMImplementationcreateDocumentrdocumentcurNode _elem_info_cdatar-s r)rtzExpatBuilder.resets@,;; T4)) } -2 r+c|j|_|j|_|j|_|j|_|jj r |j |_ |j |_ |jjr |j|_|jjr%|j|_|j|_|j|_n |j|_|j|_|j|_|j|_|j|_ dS)z>Install the callbacks needed to build the DOM into the parser.N)!start_doctype_decl_handlerStartDoctypeDeclHandlerfirst_element_handlerStartElementHandlerend_element_handlerEndElementHandler pi_handlerProcessingInstructionHandlerrnrentity_decl_handlerEntityDeclHandlernotation_decl_handlerNotationDeclHandlercommentscomment_handlerCommentHandlercdata_sectionsstart_cdata_section_handlerStartCdataSectionHandlerend_cdata_section_handlerEndCdataSectionHandlercharacter_data_handler_cdataCharacterDataHandlercharacter_data_handlerexternal_entity_ref_handlerExternalEntityRefHandlerxml_decl_handlerXmlDeclHandlerelement_decl_handlerElementDeclHandlerattlist_decl_handlerAttlistDeclHandlerr'parsers r)r~zExpatBuilder.installs*.)H&%)%?"#'#; .2o+ = ! @'+'?F $%)%?" = ! 9$($8F ! = ' F.2.NF +,0,JF )*.*KF ' '*.*EF '*.*J' $ 5$($=!$($=!!!r+cp|}d} |d}|sn<||d|r!|jjr||d}T|ddn#t $rYnwxYw|j}|d|_|S)zIParse a document from a file object, returning the document node.Tr3i@Fr+N) rreadParserdocumentElement _setup_subset ParseEscapertrs)r'filer first_bufferbufferdocs r) parseFilezExpatBuilder.parseFiles!!   %7++ VU+++/DM$A/&&v...$  % LLd # # # #    D m   sA+B BBc|} ||d||n#t$rYnwxYw|j}|d|_|S)zDL '48O 1 *4< *')D $ $ $ * * * *r+c|j||}t|j||jr?|j|t kr|j|dSdSdSr&)rcreateProcessingInstructionr rrqrr removeChild)r'targetdatanodes r)rzExpatBuilder.pi_handler s{}88FFdlD))) < +DL33D99]JJ L $ $T * * * * * + +JJr+c|jj}|jr\|jr3|djt kr|d|dS|j|}d|_nY|r1|djtkr|d}|j |z}||_ dStj }||_ |j|_ t|j|dS)NrT)rrr_cdata_continuenodeTypeCDATA_SECTION_NODE appendDatarcreateCDATASection TEXT_NODErrTextrr )r'rrrvalues r)rz)ExpatBuilder.character_data_handler_cdatas\, ; /&  n-1CCC2))$///=33D99D#'D  /JrN3y@@b>DI$EDI F<>>DDI!%D dlD)))))r+c|jj}|r/|djtkr|d}|j|z|_dSt j}|j|z|_|j|_t|j|dSr) rrrrrrrrrr )r'rrrs r)rz#ExpatBuilder.character_data_handler&s|\,  *R.1Y>>b>D D(DI F|~~I$ !]dlD)))))r+c|rdS|jjsdS|j||||}|4|j|} |j| |jjjj||j r<|j |tkr|jjjjd=dSdSdSr) rnrr_create_entitycreateTextNoderappendrrrqrr) r' entityNameis_parameter_entityrbaserr notationNamerchilds r)rz ExpatBuilder.entity_decl_handler1s   F}%  F}++J,4lDD  M0077E O " "5 ) ) ) &+224888 < 8DL33D99]JJ %.3B777 8 8JJr+c|j|||}|jjjj||jr<|j|tkr|jjjjd=dSdSdSr) r_create_notationrrrrrqr FILTER_ACCEPT)r'rrrrrs r)rz"ExpatBuilder.notation_decl_handlerCs}--lHhOO ',33D999 < 9DL33D99]JJ %/4R888 9 9JJr+c|j|}t|j||jr?|j|t kr|j|dSdSdSr&)r createCommentr rrqrrr)r'rrs r)rzExpatBuilder.comment_handlerIsy}**400dlD))) < +DL33D99]JJ L $ $T * * * * * + +JJr+c"d|_d|_dS)NTFrrr-s r)rz(ExpatBuilder.start_cdata_section_handlerOs $r+c"d|_d|_dS)NFrr-s r)rz&ExpatBuilder.end_cdata_section_handlerSs $r+cdSNr3rT)r'contextrrrs r)rz(ExpatBuilder.external_entity_ref_handlerWsqr+c|j|js t|_|j|_|||dSr&)rqrrrstart_element_handlerrr)r'rb attributess r)rz"ExpatBuilder.first_element_handlerZsJ <  ')D $/3/I, ""444444r+c|j|}t|j|||_|rvt dt |dD]W}t j||tdt}||dz}||_ |j|_ t||X||jj ur||dSdS)Nrr^r3)r createElementr rranger`rAttrrrrrr rrr)r'rbrriars r)rz"ExpatBuilder.start_element_handler`s}**400dlD)))  -1c*ooq11 - -LA!%|55"1Q3"&-#D!,,,, t}4 4 4  & &t , , , , , 5 4r+cP|jr||jjurdS|j|}|tkrt |n|t krt|ndS|j|_ |j || dSdSr&) rqrrstartContainerrRejecter FILTER_SKIPSkipper parentNoderrunlink)r'rfilts r)rrz"ExpatBuilder._finish_start_elementqs < t}444<..t44D}$$$$ ?DL O ' ' - - - KKMMMMM#  r+cV|j}|j|_||dSr&)rrr)r'rbrs r)rz ExpatBuilder.end_element_handlers-,)    )))))r+cL|j|j}|r||||jrc||jjurdS|j|tkr2|j || dSdSdSr&) rgetr$_handle_white_text_nodesrqrrrrrrr)r'rr9s r)rz ExpatBuilder._finish_end_elements""7?33  9  ) )'4 8 8 8 < !$-777|&&w//=@@ ((111      ! !A@r+c|jjs|sdSg}|jD]@}|jt kr.|js||A|D]}| |dSr&) rnwhitespace_in_element_contentrErrrrstriprr)r'rr9Lrs r)r z%ExpatBuilder._handle_white_text_nodess M 7 ((**  F _  E~**5:3C3C3E3E* $ $E   U # # # # $ $r+c|j|}|t|||j|<dS|jJ||_dSr&)rrr r#)r'rbr(r9s r)rz!ExpatBuilder.element_decl_handlersQ""4(( <$/e$<$>>.,   :::OOO****+++ ***( * * *888$999 +++ %%%%%%555 ---".*** ! ! !$$$"   BBB11111r+rkcLeZdZdZdZdZdZdZej e j ej e j eje jeje jeje jeje jeje jeje jeje jeje jeje jej e j!i Z"dS)rpzoWrapper around a DOMBuilderFilter which implements the checks to make the whatToShow filter attribute work.roc||_dSr&r)r'ros r)r*z#FilterVisibilityController.__init__s  r+c|j|j}|jj|zrV|j|}|t krt |tvrtdt|z|StS)Nz)startContainer() returned illegal value: ) _nodetype_maskrro whatToShowrFILTER_INTERRUPTr_ALLOWED_FILTER_RETURNSrareprr)r'rmaskvals r)rz)FilterVisibilityController.startContainers"4=1 ; !D ( !+,,T22C&&&!!111 ADIIMOOOJ r+c~|j|j}|jj|zr|j|}|t krt |tkr5|j}|j ddD]}| |tS|tvrtdt|z|StS)Nz%acceptNode() returned illegal value: )rrrorrrrrrr appendChildrr rar!r)r'rr"r#parentrs r)rz%FilterVisibilityController.acceptNodes"4=1 ; !D ( !+((..C&&&!!k!!!_QQQ/..E&&u----$$111 =S IKKKJ r+N)#rPrQrRrrSr*rrr ELEMENT_NODEr SHOW_ELEMENTATTRIBUTE_NODESHOW_ATTRIBUTEr SHOW_TEXTrSHOW_CDATA_SECTIONENTITY_REFERENCE_NODESHOW_ENTITY_REFERENCE ENTITY_NODE SHOW_ENTITYPROCESSING_INSTRUCTION_NODESHOW_PROCESSING_INSTRUCTION COMMENT_NODE SHOW_COMMENT DOCUMENT_NODE SHOW_DOCUMENTDOCUMENT_TYPE_NODESHOW_DOCUMENT_TYPEDOCUMENT_FRAGMENT_NODESHOW_DOCUMENT_FRAGMENT NOTATION_NODE SHOW_NOTATIONrrTr+r)rprps55I ! ! !!!!* **A **C **> **G "**J **@ (**P **A **B **G #**K **B  NNNr+rpceZdZdZdZdS) FilterCrutch)_builder_level _old_start_old_endcd|_||_|j}|j|_|j|_|j|_|j|_dSr) r@r?rsrrArrBrr)r'rWrs r)r*zFilterCrutch.__init__sG   40 %)%?"#'#;   r+N)rPrQrRrSr*rTr+r)r>r>s(>I<<<<c$eZdZdZdZdZdZdS)rrTcvt|||j}dD]}t||ddS)N)rrrrrr)r>r*rssetattr)r'rWrrbs r)r*zRejecter.__init__sQdG,,, ( (D FD$ ' ' ' ' ( (r+c$|jdz|_dSr)r@r'argss r)rzRejecter.start_element_handlerskAo r+c|jdkr@|jj}|j||j|_|j|_dS|jdz |_dSNrr3)r@r?rsr~rArrBr)r'rIrs r)rzRejecter.end_element_handler sZ ;!  ]*F M ! !& ) ) ))-F &'+}F $ $ $+/DKKKr+N)rPrQrRrSr*rrrTr+r)rrsFI ( ( (&&&*****r+rceZdZdZdZdZdS)rrTcp|jj}|j||jj|ur|jdz|_dSdSr)r?rrAr@)r'rIrs r)rzSkipper.start_element_handler-sD}$ =  , ,+/DKKK - ,r+c|jdkr5|j|jj_|j|jj_d|_dS|jdz |_|j|dSrK)r@rAr?rsrrBrrHs r)rzSkipper.end_element_handler3s\ ;!  9=DM ! 56:mDM ! 3 DMMM+/DK DM4 r+N)rPrQrRrSrrrTr+r)rr*s7I*** ! ! ! ! !r+rz8http://xml.python.org/entities/fragment-builder/internalz %%s ]> &fragment-builder-internal;c>eZdZdZd dZdZdZdZdZdZ d Z dS) FragmentBuilderzBuilder which constructs document fragments given XML source text and a context node. The context node is expected to provide information about the namespace declarations which are in scope at the start of the fragment. Nc|jtkr||_||_n|j|_||_t ||dSr&)rr5originalDocumentrrrkr*)r'rrus r)r*zFragmentBuilder.__init__[sO  } , ,$+D !"DLL$+$9D !"DLdG,,,,,r+cHt|d|_dSr&)rkrtfragmentr-s r)rtzFragmentBuilder.resetds!4    r+cP||S)zRParse a document fragment from a file object, returning the fragment node.)rrr'rs r)rzFragmentBuilder.parseFilehs  ,,,r+c||_|}|jj}d}|rH|jp|}|jrd|jd|jd}n|jr d|jz}nd}|}t|||fz} | |dn#| xYw|j }| |S)zMParse a document fragment from a string, returning the fragment node.zPUBLIC "z" ""z SYSTEM "%s"T) _sourcerrRrr_getDeclarationsrr _getNSattrs_FRAGMENT_BUILDER_TEMPLATErrtrT) r'rrridentrnsattrsrrTs r)rzFragmentBuilder.parseStringms  !!'/  +Ft/D/D/F/FF 9 9#,,,g.>.>.>@! 9%(88F""$$-0HH  LL4 ( ( ( (  JJLLL = s B//Ccb|jjj}d}|rt|jjD]Y}|j|}|r|dz}|d|j}|jr|d|jd|j d}L|d|j d}Zt|j jD]}|j |}|r|dz}|d|j}|jr|d|jd|j d }n'|j r|d|j d }n|d |j j d }|j r |d |j }|d z}|S) zRe-create the internal subset from the DocumentType node. This is only needed if we don't already have the internalSubset as a string. rXz z z SYSTEM "z )rrrrrlengthitemnodeNamerrr firstChildrr)r'rrXrnotationrs r)r[z FragmentBuilder._getDeclarationss ,,4   7,344 C C",11!44#F A)*H,=,=>$C11h///1B1B1BDAA./QQ0A0A0ABAA7+233   )..q11#F A'(qq&//:?@11fooov@AA_@,-AAv?AA%&QQ(9(>(>(>?A&D,-AAv/B/BCAGr+cdS)NrXrTr-s r)r\zFragmentBuilder._getNSattrssrr+c|tkr|j}|j}|j|}|j|_|j|_|j|_ ||j d||_||_d|_ n#||_||_d|_ wxYwdSt |||||S)NTr) $_FRAGMENT_BUILDER_INTERNAL_SYSTEM_IDrrrsExternalEntityParserCreaterRcreateDocumentFragmentrTrrZrkr)r'rrrr old_document old_cur_noders r)rz+FragmentBuilder.external_entity_ref_handlers ; ; ; =Ltjd}d|_|S)z'Create a new namespace-handling parser.r[)namespace_separatorT)r rwnamespace_prefixesrs r)rxzNamespaces.createParsers"#<<<$(! r+cpt|||jjr|j|_dSdS)z.Insert the namespace-handlers onto the parser.N)rkr~rnnamespace_declarationsstart_namespace_decl_handlerStartNamespaceDeclHandlerrs r)r~zNamespaces.installsCT6*** = / 31  , , , 3 3r+c>|j||fdS)z/Push this namespace declaration on our storage.N)rqr)r'rgres r)rxz'Namespaces.start_namespace_decl_handlers# !((&#77777r+cd|vrt||\}}}}nt}|}d}t}tj||||}|j|_t|j|||_|j r|j D]y\}}|r.tj t|d|zt|d}n!tj dtdt}||_ |j|_t||z|j dd=|r||j} |j} t%dt'|dD]} || } || dz} d| vr9t|| \}}}}tj ||||}|| |<|| ||f<n2tj | t| t}|| | <|| t| f<|j|_| |_ ||_dSdS)Nr[xmlns:xmlnsrr^r3)rirrrElementrrr rrqrrYrrr _ensure_attributes_attrs_attrsNSrr` ownerElement)r'rbrrerfrgrhrrrrrr8rs r)rz Namespaces.start_element_handlers$ $;;,:4,F,F )CFEE!CEI!Fuc69==!]dlD)))  $ -#8 - - < WT8f3D%E%E%4fgGGAA Wo%,l<|j}d|vrAt||\}}}}|j|kr|j|kr |j|ks Jdn/|j|ks Jd|jt ks Jd|j|_||dS)Nr[z$element stack messed up! (namespace)z&element stack messed up - bad nodeNamez*element stack messed up - bad namespaceURI) rrir=r>rgrdrrr)r'rbrrerfrgrhs r)rzNamespaces.end_element_handlerslGd{{0>tT0J0J-Y,33#-::#Nf444>5454'4///?0//+>>>C?>>"-DL  $ $W - - - - -r+N) rPrQrRrrrrxr~rxrrrTr+r)roroszAA'''  333888-&-&-&^.  . . . . .r+roceZdZdZdZdS)ExpatBuilderNSz*Document builder that supports namespaces.cbt||dSr&)rkrtrrr-s r)rtzExpatBuilderNS.reset)s.4    r+N)rPrQrRrrtrTr+r)rr&s)44r+rceZdZdZdZdZdS)FragmentBuilderNSz*Fragment builder that supports namespaces.cbt||dSr&)rPrtrrr-s r)rtzFragmentBuilderNS.reset1s.d### r+cd}|j}g}|rst|drZ|jD]@\}}||vr |||rd|z}nd}|r |d|d|d}7d|d|d}A|j}|s|S) zNReturn string of namespace attributes from this element and ancestors.rX_ns_prefix_urir|r}z z=''r[)rhasattrritemsrr)r'attrsrr rgredeclnames r)r\zFragmentBuilderNS._getNSattrs5s,  )w 011 =#*#9#?#?#A#A = =KFC{{ HHV$$$+#+f#4#*=5:UUHHHccc J=/7hh <(G )  r+N)rPrQrRrrtr\rTr+r)rr.s844r+rceZdZdZdS)rzEException raised to short-circuit parsing in InternalSubsetExtractor.N)rPrQrRrrTr+r)rrSsOODr+rc@eZdZdZdZdZdZdZdZdZ dZ d Z dS) rzBXML processor which can rip out the internal document type subset.Nc|jS)z'Return the internal subset as a string.)rr-s r)rz!InternalSubsetExtractor.getSubset\s {r+c` t||dS#t$rYdSwxYwr&)rkrrrVs r)rz!InternalSubsetExtractor.parseFile`sE   " "4 . . . . .    DD   --c` t||dS#t$rYdSwxYwr&)rkrr)r'rs r)rz#InternalSubsetExtractor.parseStringfsE   $ $T6 2 2 2 2 2    DD rc6|j|_|j|_dSr&)rrrrrs r)r~zInternalSubsetExtractor.installls)-)H&%)%?"""r+c|r:|}g|_|jj|_|j|_dSt r&)rrrDefaultHandlerrrr)r'rbrrrrs r)rz2InternalSubsetExtractor.start_doctype_decl_handlerpsH  ^^%%FDK$(K$6F !+/+HF ( ( (-- r+cd|jdddd}||_t)NrXz   )joinrreplacer)r'rXs r)rz0InternalSubsetExtractor.end_doctype_decl_handlerzsF GGDK ( ( 6 6 > >tT J J mmr+ctr&)r)r'rbrs r)rz-InternalSubsetExtractor.start_element_handlers mmr+) rPrQrRrrrrrr~rrrrTr+r)rrWsLL F  @@@    r+rTc|rt}nt}t|tr>t |d5}||}dddn #1swxYwYn||}|S)z{Parse a document, returning the resulting Document node. 'file' may be either a file name or an open file object. rbN)rrk isinstancestropenr)r namespacesrWfpresults r)parsers ! ""..$) $   +&&r**F + + + + + + + + + + + + + + +""4(( MsA''A+.A+cj|rt}nt}||S)zOParse a document from a string, returning the resulting Document node. )rrkr)rrrWs r)rrs6! ""..   v & &&r+c|rt|}nt|}t|tr>t |d5}||}dddn #1swxYwYn||}|S)zParse a fragment of a document, given the context from which it was originally extracted. context should be the parent of the node(s) which are in the fragment. 'file' may be either a file name or an open file object. rN)rrPrrrr)rrrrWrrs r) parseFragmentrs+#G,,!'**$) $   +&&r**F + + + + + + + + + + + + + + +""4(( MsA))A-0A-cn|rt|}nt|}||S)zParse a fragment of a document from a string, given the context from which it was originally extracted. context should be the parent of the node(s) which are in the fragment. )rrPr)rrrrWs r)parseFragmentStringrs< +#G,,!'**   v & &&r+cL|jrt|St|S)z,Create a builder based on an Options object.)rrrk)rus r) makeBuilderrs)%g&&&G$$$r+)T)3rxml.domrrrrrr xml.parsersr xml.dom.minidomr r xml.dom.NodeFilterr rrr5DOMBuilderFilterrrrrgetDOMImplementationrTypeInfor6objectr rYrirkr rpr>rrrir]rProrr ExceptionrrrrrrrrTr+r)rsZ:.---------BBBBBBBBBB>>>>>>>>)))))) N ," +9 +9 )5 .?3w355! w//  }55  x00  z22  t,,  w//  x00  y11  z22   1(1(1(1(1(&1(1(1(f,,,666&|1|1|1|1|1|1|1|1B )-E7 7 7 7 7 7 7 7 t < < < < <6 < < <*****|***8!!!!!l!!!2?%*+ +r9r9r9r9r9lr9r9r9j\.\.\.\.\.\.\.\.~Z""""" O"""J     )   )))))l)))X$''''( ' ' ' '%%%%%r+PKN\nxۑ*dom/__pycache__/NodeFilter.cpython-311.pycnu[ !A?h GddZdS)cXeZdZdZdZdZdZdZdZdZ dZ dZ dZ d Z d Zd Zd Zd ZdZdZdZdS) NodeFilterzL This is the DOM2 NodeFilter interface. It contains only constants. l @iiict)N)NotImplementedError)selfnodes ?/opt/alt/python-internal/lib64/python3.11/xml/dom/NodeFilter.py acceptNodezNodeFilter.acceptNodes!!N)__name__ __module__ __qualname____doc__ FILTER_ACCEPT FILTER_REJECT FILTER_SKIPSHOW_ALL SHOW_ELEMENTSHOW_ATTRIBUTE SHOW_TEXTSHOW_CDATA_SECTIONSHOW_ENTITY_REFERENCE SHOW_ENTITYSHOW_PROCESSING_INSTRUCTION SHOW_COMMENT SHOW_DOCUMENTSHOW_DOCUMENT_TYPESHOW_DOCUMENT_FRAGMENT SHOW_NOTATIONrrrrrsMMK",H",L",N",I",",",K",",L",M",",",M"""""rrN)rr)rrr*s7""""""""""rPKN\ill-dom/__pycache__/minidom.cpython-311.opt-2.pycnu[ !A?h,  ddlZddlZddlmZmZmZmZddlTddlm Z m Z ej j j ej j jfZGddej j Z ee dd ee d d ee d d dZdZdZdZdZGdde ZGdde Zeedd eed d eedd GddeZeedd eZGd d!eZeddZGd"d#e Zeed$d% eed d& d'ZGd(d)ZGd*d+ee Z Gd,d-ee Z!ee!dd. Gd/d0e!Z"ee"d1d2 ee"d3d4 d5Z#d6Z$Gd7d8e!Z%Gd9d:e"Z&Gd;dd?Z(Gd@dAe(ee Z)GdBdCe(e Z*GdDdEe(ee Z+GdFdGe Z,GdHdIeZ-dJZ.GdKdLe e Z/ee/dMdN dOZ0dPZ1dQZ2dUdRZ3dVdSZ4dVdTZ5dS)WN)EMPTY_NAMESPACE EMPTY_PREFIXXMLNS_NAMESPACEdomreg)*)DOMImplementationLS DocumentLSceZdZdZdZdZdZdZeZ dZ ddZ ddZ dZ dZd Zd Zd Zd Zd ZdZdZdZdZdZdZdZdZdZdZdZdZdZ dS)NodeNcdS)NTselfs t jt|dt||j |j ||| |n |j |}n,#t$rt jwxYw|jt vrt#||j||||_||_|r|j|dz }||_||_nd|_||_ |S)N cannot be child of )r%DOCUMENT_FRAGMENT_NODEtupler0 insertBefore_child_node_typesxmldomHierarchyRequestErrrepr parentNode removeChild appendChildindex ValueError NotFoundErr_nodeTypes_with_children_clear_id_cacheinsert nextSiblingpreviousSibling)rnewChildrefChildcrKnodes rrBzNode.insertBeforeRs   ; ; ;8.// / /!!!X....O  D$: : :'--.28nnnnd4jjjIKK K   *   + +H 5 5 5     X & & & & ,--h77 , , ,g))+++ , $<<<%%% O " "5( 3 3 3#+H '/H $ 0uQw/#+ +/((+/("&H s C!!)D c|j|jkr.t|jD]}|||S|j|jvr>t jt|dt||jtvrt||j |j |t||d|_|SNr>)r%r@rAr0rJrCrDrErFrGrNrOrHrI _append_childrQ)rrVrUs rrJzNode.appendChildrs =D7 7 74?++ $ $  ####K = 6 6 6'--.24jjjj$t***EGG G ]6 6 6 D ! ! ! ? & O ' ' - - -dD!!! rc|j|jkr2|j}|||||S|j|jvr>t jt|dt|||urdS|j |j | |j |}n,#t$rt jwxYw||j |<||_ d|_ |jtvs|jtvrt!||j|_|j|_d|_d|_|jr ||j_|jr ||j_|SrX)r%r@rQrIrBrCrDrErFrGrHr0rKrLrMrNrOrR)rrSoldChildrTrKs r replaceChildzNode.replaceChilds   ; ; ;+H   X & & &$$Xx88 8  D$: : :'--.28nnnnd4jjjIKK K x   F   *   + +H 5 5 5 (O))(33EE ( ( ('%%'' ' (!)""  !9 9 9 $<<< D ! ! !'3#+#; ##'  # <3;H $ 0   <3;H 0s 7C)C;cZ |j|n,#t$rtjwxYw|j|j|j_|j|j|j_dx|_|_|jtvrt|d|_ |Sr.) r0removerLrDrErMrQrRr%rNrOrHrr[s rrIzNode.removeChilds ( O " "8 , , , , ( ( ('%%'' ' (   +3;3KH 0  # /3;3GH $ 0:>>x7   8 8 8 D ! ! !" )Aclg}|jD]}|jtjkr|jsA|r|j|d_|jr|j|j_|`|rf|dj|jkrP|d}|j|jz|_|j|_|jr ||j_||||||jtj kr| ||jdd<dSr:) r0r%r TEXT_NODEdatarQrRunlinkappend ELEMENT_NODE normalize)rLchildrVs rrgzNode.normalizes, _ & &E~//z$>,1,=")(RU^;;R5D $ EJ 6DI','8D$(A<@)9LLNNNNHHUOOOO>T%666OO%%%rc2t|||jp|Sr.) _clone_node ownerDocument)rdeeps r cloneNodezNode.cloneNodes4t'9'ATBBBrcB|jj||Sr.)rlimplementation hasFeaturerfeatureversions r isSupportedzNode.isSupporteds!0;;GWMMMrcdSr.r rs r_get_localNamezNode._get_localNamestrc ||uSr.r rothers r isSameNodezNode.isSameNodes u}rc6||dr|SdSr.)rurrss r getInterfacezNode.getInterfaces$   GT * * K4rcZ |j|dS#ttf$rYdSwxYwr7) _user_dataAttributeErrorKeyErrorrkeys r getUserDatazNode.getUserDatas@ ?3'* *)   44 s **cd} |j}n#t$r i}||_YnwxYw||vr||d}|d}|||=n||f||<|Sr7)rr)rrrchandleroldds r setUserDatazNode.setUserDatas AA   ADOOO  !88C&)C <GcFG_AcF s  ""ct|drJt|jD]%\}\}}|||||||$dSdS)Nr)hasattrlistritemshandle)r operationsrcdstrrcrs r_call_user_data_handlerzNode._call_user_data_handlers~ 4 & & C(,T_-B-B-D-D(E(E C C$_dG&NN9c4cBBB C C C Crcdx|_|_|jr1|jD]}|t |_d|_d|_dSr.)rHrlr0rdNodeListrRrQ)rris rrdz Node.unlinks\/33$, ? )   &jjDO#rc|Sr.r rs r __enter__zNode.__enter__s rc.|dSr.)rd)retevtbs r__exit__z Node.__exit__s rNN)rrNN)!__name__ __module__ __qualname__ namespaceURIrHrlrQrRrprefixrrrr1r4r8r<rBrJr\rIrgrnrurwr{r~rrrrdrrr rrr r "sLJMKO F>>>><@#....&%%%&&&'''@"@ 6CCCNNN  $CCC   rr firstChildzFirst child node, or None.)doc lastChildzLast child node, or None. localNamez"Namespace-local name of this node.c||j}|r|d}||_||_||||_dSr:)r0rRrQrerH)rrVr0lasts rrYrYsIJ "~#dDOOOrcJ| |jtjkrdS|j}| dSNTF)r%r r&rHrVs r _in_documentr's3   =D. . .4   5rc |ri|dddddddd}||dSdS) N&z&z>)replacewrite)r,rcs r _write_datar/sr! ||C))11#v>>GD(++GGC,@,@  Trc|jD]N}|jtjkr&|dks |j|kr||t |||O|SNr)r0r%r rftagNamere_get_elements_by_tagName_helper)parentnamercrVs rrr6sb!88 =D- - - S[[DLD00 IIdOOO'dB7777 Irc|jD]`}|jtjkrI|dks |j|kr&|dks |j|kr||t||||a|Sr)r0r%r rfrrre"_get_elements_by_tagName_ns_helper)rnsURIrrrVs rrr>s|!KK =D- - -c!!T^y%@%@#!2e!;!; $ .tUIr J J J IrceZdZejZdZdZdZdZ ej ej ej ej ejejejfZdZdS)DocumentFragmentz#document-fragmentNc,t|_dSr.)rr0rs r__init__zDocumentFragment.__init__Us"**r)rrrr r@r%nodeName nodeValue attributesrHrfrbCDATA_SECTION_NODEENTITY_REFERENCE_NODEPROCESSING_INSTRUCTION_NODE COMMENT_NODE NOTATION_NODErCrr rrrrGsp*H#HIJJ*039*+ -%%%%%rrceZdZdZejZdZdZdZ ej ej fZ e ddfdZdZdZdZdZeeexZZd Zd ZeeexZZd Zd ZeeeZd ZdZdZdS)Attr)_name_valuer_prefixr0 _localNamerl ownerElementNFcd|_||_||_||_|||_t |_|jtdSr.) rrrrrrr0reText)rqNamerrrs rrz Attr.__init__csZ  (  'DO"** tvv&&&&&rct |jS#t$r$|jdddcYSwxYwN:r?r;)rrrsplitrs rrwzAttr._get_localNamersM 3? " 3 3 3=&&sA..r2 2 2 2 3  +77c|jSr.) specifiedrs r_get_specifiedzAttr._get_specifiedx ~rc|jSr.)rrs r _get_namezAttr._get_name{ zrcN||_|jt|jdSdSr.)rrrOrvalues r _set_namezAttr._set_name~s1   ( D- . . . . . ) (rc|jSr.)rrs r _get_valuezAttr._get_value {rc||_||jd_|jt |j||jd_dSr7)rr0rcrrOrs r _set_valuezAttr._set_valuesG "'   ( D- . . ."'rc|jSr.)rrs r _get_prefixzAttr._get_prefix |rc|j}|dkr,|r*|tkrtjd||_||j}n |d|j}|jrt|j||_ dS)Nxmlnsz5illegal use of 'xmlns' prefix for the wrong namespacer) rrrDrE NamespaceErrrrrrOr)rrnsurinewNames r _set_prefixzAttr._set_prefixs! W   M/11g**KMMM >nGG!'8G   / D- . . . rc|j}|T|j|j=|j|j|jf=|jr,d|_|xjdzc_|jxj dzc_ |j D]}| |j dd=dS)NFr?) r_attrsr_attrsNSrr_is_id_magic_id_nodesrl_magic_id_countr0rd)relemris rrdz Attr.unlinks     DM* t0$.AB{ 8# $$)$$"22a722_  E LLNNNN OAAA   rc|jrdS|j}|j}||dS||}|dS|jr ||j|jS||jSr) rrlr_get_elem_inforisIdNSrisIdrrrrinfos r _get_isIdzAttr._get_isIds ; 4   ;$,5!!$'' <5   ,;;t0$.AA A99T]++ +rc|j}|j}||tS||}|tS|jr ||j|jS||jSr.) rlr_no_typerrgetAttributeTypeNSrgetAttributeTyperrs r_get_schemaTypezAttr._get_schemaTypesy   ;$,O!!$'' <O   8**4+tjt |dt ||j|j}|r| ||j|j<||j |j |j f<|j |_t|j|SrX)rrrDrErFrGrr(rrdrrrr rrO)rrVrs rr>zNamedNodeMap.setNamedItemas$%% G'--.24jjjj$t***EGG Gkoodi((   JJLLL!% DI=A t($.9: .)*** rc,||Sr.)r>rrVs rsetNamedItemNSzNamedNodeMap.setNamedItemNSns  &&&rcf||}t|j|dSr.)rOrrd)rr;rVs r __delitem__zNamedNodeMap.__delitem__qs/$%)*** rc*|j|j|jfSr.r rs r __getstate__zNamedNodeMap.__getstate__vs{DM4+===rc0|\|_|_|_dSr.r rstates r __setstate__zNamedNodeMap.__setstate__ys9>6 T]D$6$6$6rr.) rrrrrrrrrr!rr$rr(__len__r,r/r2r4r7r9r<rArDrGrLrOr>rSrUrWr[r rrr r s8I***       ((( """$$$$$$,,,,GCCC %%%%%%$$$%%%$$$111 $ $ $  ( ( ( ( ( (   ''' >>>?????rr lengthz$Number of nodes in the NamedNodeMap.c*eZdZdZdZdZdZdZdS)TypeInfo namespacerc"||_||_dSr.r`)rrars rrzTypeInfo.__init__s" rc|jr d|jjd|jd|jdSd|jjd|jdS)Nr z (from z)>r)ra __class__rrrs r__repr__zTypeInfo.__repr__s` > D D*..*A*A*A4999*....: : D!% 7 7 7C Crc|jSr.)rrs rrzTypeInfo._get_name yrc|jSr.)rars r_get_namespacezTypeInfo._get_namespacerrN)rrrrrrfrrjr rrr_r_sX#IDDDrr_c&eZdZdZejZdZeZ dZ ejej ej ej ejejfZeddfdZdZdZdZdZd Zd Zd Zd Zd ZdZdZeZdZdZ dZ!e!Z"dZ#dZ$dZ%dZ&dZ'ddZ(dZ)dZ*dZ+dZ,dZ-dS) Element) rlrHrrrrrr0rrrQrRNrcd|_|x|_|_||_||_t |_dx|_|_d|_ d|_ dSr.) rHrrrrrr0rQrRrr)rrrrrs rrzElement.__init__sU'.. t} ("**2664/  rc4|ji|_i|_dSdSr.)rrrs r_ensure_attributeszElement._ensure_attributess$ ; DKDMMM  rct |jS#t$r$|jdddcYSwxYwr)rrrrrs rrwzElement._get_localNamesM 2? " 2 2 2<%%c1--b1 1 1 1 2rc|jSr.rrs r _get_tagNamezElement._get_tagNamerrc|j=t|jD]}|d|_d|_t |dSr.)rrrrdrr )rattrs rrdzElement.unlinksd ; "T[//1122      Drc^ |jdS |j|jS#t$rYdSwxYwr)rrr)rr@s r getAttributezElement.getAttributesM  ; 2 ;w'- -   22 s  ,,c`|jdS |j||fjS#t$rYdSwxYwr)rrrrFs rgetAttributeNSzElement.getAttributeNSsK = 2 =, !:;A A   22 s  --c||}|9t|}||_|j|_||dS||jkr||_|jrt |dSdSdSr.)getAttributeNoderrrlsetAttributeNoderrO)rr@rrus r setAttributezElement.setAttributes$$W-- <==DDJ!%!3D   ! !$ ' ' ' ' ' dj DJy &%%%%%!  & &rcXt|\}}|||}| t||tSr.rrrCs rgetElementsByTagNamezElement.getElementsByTagNameXs /tT8::FFFrc>t|||tSr.rrrFs rgetElementsByTagNameNSzElement.getElementsByTagNameNS`!1 , 8::77 7rc4d|jt|fzS)Nz)rr+rs rrfzElement.__repr__ds)T\2d88,DDDrrcD ||dz|jz|}|D]J}|d|zt |||j|dK|jr|dt|jdkrN|jdjtj tj fvr$|jd |dddnO|||jD]}| |||z|||||d|jd|dS|d |zdS) Nrz %s="rrr?rrz%s) rr_get_attributesrrrr0rr%r rbrr')rr,r* addindentr+ra_namerVs rr'zElement.writexmlgs   VCZ$,.///$$&&jjll  F LLF* + + + f 3 4 4 4 LL     ? ( LL   DO$$))"+(?0AAA"++FBB???? T""" OMMDMM&&*:ItLLLL V$$$ LLLdlllDD9 : : : : : LL ' ' ' ' 'rc`|t|j|j|Sr.)ror rrrs rrzElement._get_attributess* !!!DK===rc|jrdSdSrrrs r hasAttributeszElement.hasAttributess ; 45rcZ||}||dSr.)r{setIdAttributeNode)rridAttrs rsetIdAttributezElement.setIdAttributes/&&t,, '''''rc\|||}||dSr.)rr)rrrrs rsetIdAttributeNSzElement.setIdAttributeNSs1((yAA '''''rc\|||jstjt |tj|js=d|_|xjdz c_|j xj dz c_ t|dSdS)NTr?) r{rrDrErM_get_containing_entrefNoModificationAllowedErrrrrlrrO)rrs rrzElement.setIdAttributeNodes >1D!E!E>'%%'' ' !$ ' ' 3'2244 4} " FM  A %   . .! 3 . . D ! ! ! ! !  " "rrrr).rrrrr rfr%rrr rrrrbrrrCrrrorwrsrdrwryr}rr{rr|setAttributeNodeNSrrrremoveAttributeNodeNSrrrrrfr'rrrrrr rrrlrls1I HIJO*9*03 5.=T( 222   & & &..."))) <<< &*''''''   0###::: GGG777EEE((((@>>>(((((( " " " " "rrlrz*NamedNodeMap of attributes on the element.z%Namespace-local name of this element.ct||||j|j<||j|j|jf<||_dSr.)rOrorrrrrr)elementrus rrrsWG    $GN49<@Gd'89  DrcdeZdZ dZdZeZdZdZdZ dZ dZ dZ dZ dZd Zd ZdS) Childlessr NcdSr.r rs rr8zChildless._get_firstChildrrcdSr.r rs rr<zChildless._get_lastChildrrcPtj|jdz)Nz nodes cannot have childrenrDrErFrrRs rrJzChildless.appendChild'g)) M9 9;; ;rcdSrr rs rr1zChildless.hasChildNodesurcPtj|jdzNz nodes do not have childrenrrrSrTs rrBzChildless.insertBeforerrcPtj|jdzr)rDrErMrr_s rrIzChildless.removeChilds'g!! M9 9;; ;rcdSr.r rs rrgzChildless.normalizes rcPtj|jdzrrrrSr[s rr\zChildless.replaceChildrr)rrrrr EmptyNodeListr0rrr8r<rJr1rBrIrgr\r rrrrsIJJJI;;;;;;;;;   ;;;;;rrcveZdZejZdZdZdZdZ e ee Z dZ dZ e e e Zd dZd S) ProcessingInstructiontargetrcc"||_||_dSr.r)rrrcs rrzProcessingInstruction.__init__s  rc|jSr.rcrs r_get_nodeValuez$ProcessingInstruction._get_nodeValuerhrc||_dSr.rrs r_set_nodeValuez$ProcessingInstruction._set_nodeValues  rc|jSr.rrs r _get_nodeNamez#ProcessingInstruction._get_nodeNamerrc||_dSr.rrs r _set_nodeNamez#ProcessingInstruction._set_nodeNames  rrc Z||d|jd|jd|dS)Nz)rrrcrr,r*rr+s rr'zProcessingInstruction.writexmls5 t{{{DIIIttLMMMMMrNr)rrrr rr%rrrrrrrrrr'r rrrrs/H"I 88Ix }55HNNNNNNrrcneZdZdZdZdZeZdZdZe eexZ Z dZ dZ dZd Zd Zd Zd S) CharacterData)_datarlrHrRrQcdx|_|_dx|_|_d|_t |dSr)rlrHrRrQrr rrs rrzCharacterData.__init__s@/33T_266t/  drc*t|jSr.)rrcrs rrzCharacterData._get_length49~~rc|jSr.rrs r _get_datazCharacterData._get_datarrc||_dSr.rrrcs r _set_datazCharacterData._set_data s  rcz|j}t|dkrd}nd}d|jjd|dd|dS)N z...rz)rcrrer)rrc dotdotdots rrfzCharacterData.__repr__sOy t99r>>III N # # #T!B$ZZ< > >..""y) $ 2 ? )rcrLrrs rr'zComment.writexmlsI 49  DEE E  44@AAAAArNr) rrrr rr%rrr'r rrrrsJ HHBBBBBBrrc,eZdZdZejZdZddZdS) CDATASectionr z#cdata-sectionrc|jddkrtd|d|jzdS)Nz]]>rz$']]>' not allowed in a CDATA sectionz)rcfindrLrrs rr'zCDATASection.writexmlsJ 9>>% A % %CDD D % 122222rNr) rrrrr rr%rr'r rrrrs:I&HH333333rrcbeZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdS)ReadOnlySequentialNamedNodeMap_seqr c||_dSr.r)rseqs rrz'ReadOnlySequentialNamedNodeMap.__init__s  rc*t|jSr.rrrs rr\z&ReadOnlySequentialNamedNodeMap.__len__rrc*t|jSr.rrs rrz*ReadOnlySequentialNamedNodeMap._get_lengthrrc8|jD]}|j|kr|cSdSr.)rrrJs rrDz+ReadOnlySequentialNamedNodeMap.getNamedItems8  AzT!!"  rcN|jD]}|j|kr|j|kr|cSdSr.)rrrrNs rrGz-ReadOnlySequentialNamedNodeMap.getNamedItemNSs@  A~--!+2J2J  rct|tr |j|}n||}|t ||Sr.)rrArGrDr)r name_or_tuplerVs rr<z*ReadOnlySequentialNamedNodeMap.__getitem__sP mU + + 4&4& 6DD$$]33D <=)) ) rcP|dkrdS |j|S#t$rYdSwxYwr7)rrrs rrz#ReadOnlySequentialNamedNodeMap.itemsD 1994 9U# #   44 s  %%c@tjdNz"NamedNodeMap instance is read-onlyrDrErrCs rrLz.ReadOnlySequentialNamedNodeMap.removeNamedItemg.. 022 2rc@tjdr'r(rFs rrOz0ReadOnlySequentialNamedNodeMap.removeNamedItemNSr)rc@tjdr'r(rRs rr>z+ReadOnlySequentialNamedNodeMap.setNamedItemr)rc@tjdr'r(rRs rrSz-ReadOnlySequentialNamedNodeMap.setNamedItemNSr)rc|jgSr.rrs rrWz+ReadOnlySequentialNamedNodeMap.__getstate__s  {rc |d|_dSr7rrYs rr[z+ReadOnlySequentialNamedNodeMap.__setstate__s!H rN)r )rrrrrr\rrDrGr<rrLrOr>rSrWr[r rrrrsI  222222222222rrz&Number of entries in the NamedNodeMap.c&eZdZ dZdZdZdZdS) IdentifiedpublicIdsystemIdc"||_||_dSr.r1)rr2r3s r_identified_mixin_initz!Identified._identified_mixin_inits    rc|jSr.)r2rs r _get_publicIdzIdentified._get_publicId }rc|jSr.)r3rs r _get_systemIdzIdentified._get_systemIdr8rN)rrrrr5r7r:r rrr0r0 sIJ&I!!!rr0cJeZdZejZdZdZdZdZ dZ dZ dZ dZ ddZdS) DocumentTypeNct|_t|_|rt|\}}||_|j|_dSr.)rentities notationsrrr)rrrrs rrzDocumentType.__init__$sJ688 799  " ( 7 7 FI!DI  rc|jSr.)internalSubsetrs r_get_internalSubsetz DocumentType._get_internalSubset, ""rc|jetd}|j|_|j|_tjjj}|r g|j_ g|j _ |j j D]X}t|j|j |j }|j j |||||Y|jj D]}t!|j|j |j |j}|j|_|j|_|j|_|jj ||||||||||SdSr.)rlr<rrrDrEUserDataHandler NODE_CLONEDr>rr?Notationr2r3rerEntity notationNameactualEncodingrrt)rrmclonerrKnotationeentitys rrnzDocumentType.cloneNode/s^   % &&EEJ!YEN/;I D&(#')$,FFA' AJ KKHO(//999--iHEEEE+DDA#AJ AJ$%N44F,-,@@@)), FFG )((( OOG $ $ $  =9< r8rc|jSr.) errorHandlerrs r_get_errorHandlerzDocument._get_errorHandlerAs   rc|jSr.)rrs r_get_standalonezDocument._get_standaloneDr5rc|jSr.)strictErrorCheckingrs r_get_strictErrorCheckingz!Document._get_strictErrorCheckingGs ''rc|jSr.r\rs rr]zDocument._get_versionJrrc|j|jvr>tjt |dt ||j|j||jtj kr3| rtjdt ||S)Nr>z two document elements disallowed) r%rCrDrErFrGrHrIr rf_get_documentElementrJrRs rrJzDocument.appendChildMs = 6 6 6'--.24jjjj$t***EGG G ? & O ' ' - - - =D- - -((** .'--244 4d+++rc |j|n,#t$rtjwxYwdx|_|_d|_|j |urd|_ |Sr.) r0r^rLrDrErMrQrRrHdocumentElementr_s rrIzDocument.removeChild]s ( O " "8 , , , , ( ( ('%%'' ' (:>>x7"  8 + +#'D r`cL|jD]}|jtjkr|cSdSr.)r0r%r rfrRs rrzDocument._get_documentElementis;O  D} 111 2  rc|j |jd|_t|dSr.)rtrdr rs rrdzDocument.unlinkns= < # L   ! ! !DL Drc|sdS|jddd}|j|_|j|_|j|_|jD]f}t |||}|j||jtj krn|jtj kr||_ ||_ g|tjjj|||Sr.)rprvrrrtr0rkrer%r r&rRrtrHrrDrErErF)rrmrKrK childclones rrnzDocument.cloneNodets 4#224tDD?   * *A$Qe44J   # #J / / /"d&8888$(??? * $)J ! ! $$SW%<%H%)5 2 2 2 rc0t}||_|Sr.)rrl)rrs rcreateDocumentFragmentzDocument.createDocumentFragments   rc2t|}||_|Sr.)rlrl)rrrMs r createElementzDocument.createElements G  rct|tstdt}||_||_|SNznode contents must be a string)rr r?rrcrl)rrcts rcreateTextNodezDocument.createTextNodes?$$$ ><== = FFrct|tstdt}||_||_|Sr)rr r?rrcrlrrcrUs rcreateCDATASectionzDocument.createCDATASections?$$$ ><== = NNrc2t|}||_|Sr.)rrlrs r createCommentzDocument.createComments DMMrc4t||}||_|Sr.)rrl)rrrcps rcreateProcessingInstructionz$Document.createProcessingInstructions !&$ / /rc@t|}||_d|_|Sr)rrlr)rras rcreateAttributezDocument.createAttributes KKrcZt|\}}t|||}||_|Sr.)rrlrl)rrrrrrMs rrszDocument.createElementNSs1$]33 M< 8 8rcjt|\}}t||||}||_d|_|Sr)rrrlr)rrrrrrs rcreateAttributeNSzDocument.createAttributeNSs:$]33  i @ @rc8t||||}||_|Sr.)rHrl)rrr2r3rIrMs r_create_entityzDocument._create_entitys! 48\ : :rc6t|||}||_|Sr.)rGrl)rrr2r3rKs r_create_notationzDocument._create_notations T8X . .rc||jvr |j|S|js |jsdS|j}||jg}||_n|sdSd}|rx|}|d|jD||}|r|j D]}|j rG| |j |j r&||j|j<|j|kr|}F|jsntP||jr'||j|j<|j|kr|}|jsn3|jr*||j|j<|j|kr|}|jdkrnnF|jr?|j D]%}|jr||j|j<|j|kr|}&|n|x|S)Nc.g|]}|jtv|Sr )r%rN).0ris r z+Document.getElementById..s2IIIE"^/GGG GGGrr?)rrrrrpopextendr0rrrrrrrrrrr)rr+stackresultrVrrus rgetElementByIdzDocument.getElementByIdsN   >"% % 4#7 4% =)*E$)D ! ! 4& 99;;D LLIIT_III J J J&&t,,D *!O2244""D(";;t'8$.II&9=DN4:6#zR//)-%)%9& %49-- "59tz2:++%)FF!%!5"!E""59tz2:++%)FF!1Q66!E% * O2244**D{*59tz2:++%)F!M& N rc<t||tSr.rrCs rrzDocument.getElementsByTagNames.tT8::FFFrc>t|||tSr.rrFs rrzDocument.getElementsByTagNameNS rrc8|j||Sr.)rprqrrs rruzDocument.isSupporteds"--gw???rc|jtjkrtjd|jtjkrtjdt|||S)Nzcannot import document nodesz!cannot import document type nodes)r%r r&rDrENotSupportedErrrRrk)rrVrms r importNodezDocument.importNodesb =D. . .'))*HII I ]d5 5 5'))*MNN N4t,,,rrcg}|r|d|d||d|rdndd|dd|d||jD]}|||||dS) Nz encoding="rz standalone="yesnoz@@@ FI :, , ,nG"++A...G  % :* * *AIIAF"((+++2..q111 r)rrrNN)=rrrrr rfrrrRrCrgrpr&r%rrrrHrRrQrJrrrtrrrrrrrWrrrZrrrr]rJrIrrdrnrrrrrrrrsrrrrrrrurr'rr rrr{r{ s@I*D,L*D,CE'&((N!HHIJJ$((Ok NHJGLKO%%%(((###   !!!(((,,,     *        888tGGG777@@@---KO  ; ; ; ; 33333rr{rz#Top-level element of this document.c |j|rtjjj}ntjjj}|jtj kr| |j |j }|j D]T}||j |j |j||j |j}|j|_U|r0|jD](}t+|||}||)n<|jtjkrH|}|r0|jD](}t+|||}||)n|jtjkr||j}n|jtjkr||j}n}|jtjkr"||j |j}nF|jtj!kr|"|j}n|jtj#kr5|$|j |j }d|_|j|_n|jtj%krtjjj}|j&'|j(|j)|j*}||_|r:g|j+_,g|j-_,|j-j,D]o} t]| j | j)| j*} || _|j-j,/| ta| dr| 1|| | p|j+j,D]} te| j | j)| j*| j3} | j4| _4| j5| _5| j6| _6|| _|j+j,/| ta| dr| 1|| | n/tj7dtq|zta|dr|1||||S)NTrzCannot clone node %s)9rlr{rDrErErF NODE_IMPORTEDr%r rfrsrrrrrrrrrr0rkrJr@rrbrrcrrrrrrrrrrRrprxrr2r3r>rr?rGrerrrHrIrJrrtrrG) rVrmnewOwnerDocumentrrKrurrirUrKrLrMrNs rrkrkas; $$%566:G+7 G+9  }))) 001B15@@O**,, ) )D  !2DM4: N N N(():DNKKA.AKK  % % %t-=>>!!!$$$$ $5 5 5 7799  % % %t-=>>!!!$$$$ $. ( ( // :: $1 1 1 33DI>> $: : : <3H==H  DAq*55a;; tt   ""rrr.)6r!rrDrrrrxml.dom.minicompatxml.dom.xmlbuilderrr rEr rfrrN defpropertyrYrrrrrrobjectr  AttributeListr_rrlrrrrrrrrrrr0r<rHrGrgr}rOr{rkrrrrrr rrrs" JJJJJJJJJJJJ >>>>>>>> GL5GL>@ttttt37<tttl D,$@AAAA D+$?@@@@ D+$HIIII%%%%%t%%%$y8y8y8y8y84y8y8y8v D&$FGGGG D+$MNNNN D,$EFFFFa?a?a?a?a?6a?a?a?F L(68888 v( 8D$  L"L"L"L"L"dL"L"L"\ G\<>>>> G[79999    &;&;&;&;&;&;&;&;RNNNNNItNNN4ECECECECECItECECECN M8)EFFFFS+S+S+S+S+=S+S+S+j D0.//// D+@BBBB B B B B Bm B B B 3 3 3 3 34 3 3 3<<<<<V<<<| *H8::::        ::::::y$:::x&9&9&9&9&9Z&9&9&9P88888z9d888MMMMM+MMM^(((((&(((T222QQQQQtZQQQf  H'57777OOOd!!!44445555######rPKN\\ODD0dom/__pycache__/xmlbuilder.cpython-311.opt-2.pycnu[ !A?hc0 ddlZddlZddlmZgdZGddZGddZdZGd d e Z Gd d e Z Gd dZ [GddZ GddZdS)N) NodeFilter) DOMBuilderDOMEntityResolverDOMInputSourcec\eZdZ dZdZdZdZdZdZdZ dZ dZ dZ dZ dZdZdZdZdZdZdZdZdS)OptionsTFN)__name__ __module__ __qualname__ namespacesnamespace_declarations validationexternal_parameter_entitiesexternal_general_entitiesexternal_dtd_subsetvalidate_if_schemavalidatedatatype_normalizationcreate_entity_ref_nodesentitieswhitespace_in_element_contentcdata_sectionscommentscharset_overrides_xml_encodinginfosetsupported_mediatypes_only errorHandlerfilter?/opt/alt/python-internal/lib64/python3.11/xml/dom/xmlbuilder.pyrr s~J!J"& $H""H$(!NH%)"G %L FFFr!rc DeZdZdZdZdZdZdZdZdZ eeee fZ dZ dZ dZ d Zd Zd Zd Zd ZdZdZiddgddgddgddgddgddgddgddgddgddgdddgddgddgddgddgddgd d gd!gd"gd#gggd$d%gd&gd'gd(Zd)Zd*Zd+Zd,Zd-ZdS).rNr c,t|_dSN)r_optionsselfs r"__init__zDOMBuilder.__init__9s  r!c|jSr(entityResolverr*s r"_get_entityResolverzDOMBuilder._get_entityResolver<s ""r!c||_dSr(r.)r+r/s r"_set_entityResolverzDOMBuilder._set_entityResolver>s,r!c|jSr(rr*s r"_get_errorHandlerzDOMBuilder._get_errorHandlerAs   r!c||_dSr(r4)r+rs r"_set_errorHandlerzDOMBuilder._set_errorHandlerCs(r!c|jSr(rr*s r" _get_filterzDOMBuilder._get_filterFs {r!c||_dSr(r9)r+rs r" _set_filterzDOMBuilder._set_filterHs  r!cr||rt|rdpd} |jt||f}|D]\}}t|j||dS#t $r$t jd|dwxYwt j dt|z)Nr rzunsupported feature: zunknown feature: ) supportsFeature _settings _name_xformsetattrr)KeyErrorxmldomNotSupportedErr NotFoundErrrepr)r+namestatesettingsvalues r" setFeaturezDOMBuilder.setFeatureKs    % % HKa$1E 8>;t+<+BC C'%%&9DJJ&FGG Gs A.BcFt|jt|Sr()hasattrr)r@)r+rHs r"r>zDOMBuilder.supportsFeatureYst}k$&7&7888r!c>t||rdpdf}||jvS)Nr r)r@r?)r+rHrIkeys r" canSetFeaturezDOMBuilder.canSetFeature\s*4  %+A"23dn$$r!rr)rr )rr)rr)rr )rr)rr rrrr)rr rr)rr )rrrr rr)rr )rrrr rrrr ) rRrSrTrUrW)rr rVrXrZrrr rr r )rXrYrZ)rr)rr r[r\r]cdt|} t|j|S#t$r|dkrI|j}|jo8|jo1|jo*|jo#|jp|j p|j p |j p|j cYStjdt!|zwxYw)Nrzfeature %s not known)r@getattrr)AttributeErrorrrrrrrrrrrCrDrFrG)r+rHxnameoptionss r" getFeaturezDOMBuilder.getFeaturesD!! K4=%00 0 K K Ky  -6<#A<#,<$B<")!?";$+$>";$+$C";%,$4";%,$: < ==='%%&rQr?rcrirfr{rrr r!r"rr,sNL FN !$&?)+?AN"""###---!!!))) H H H999%%%;% )(+; & )(+;   ; ) ,+.; ) ,+.; + .-0; + .-0; " %$';" ' *),#;& ' *),';*  * +;0  1;4 - 0/25;8 - 0/29;<  ! #=;@  ! #A;D  E;J  203 203 3 3 3 -+.  s;;;IzKKK$!!!333AAA )))))r!rcR|ddS)N-_)lowerreplace)rHs r"r@r@s ::<<  S ) ))r!c*eZdZdZdZdZdZdZdS)r)_openerct}||_||_|||_|||_ddl}ddl }|j |}|\}}} } } } | rT| ds?| | dz} ||| | | | f}|j ||_|S)Nr/)rpublicIdrn _get_openeropenrm_guess_media_encodingencoding posixpath urllib.parserfurlparseendswithdirname urlunparsebaseURI) r+rrnsourcerrtpartsschemenetlocpathparamsqueryfragments r"rezDOMEntityResolver.resolveEntitys!!"" ,,..33H==44V<< '&&&&&&& %%h//8=5feX  < c** <$$T**S0DFD&%AE#\44U;;FN r!cr |jS#t$r#||_|jcYSwxYwr()rr`_create_openerr*s r"rzDOMEntityResolver._get_openersK <    ..00DL<    s  *66c<ddl}|jSrk)rorp build_opener)r+rts r"rz DOMEntityResolver._create_openers"~**,,,r!c|j}d|vr\|D]I}|dr0|dddcSHdSdS)Nz Content-Typezcharset==r )rminfogetplist startswithsplitr)r+rrparams r"rz'DOMEntityResolver._guess_media_encodings %%'' T ! ! : :##J//: ;;sA..q17799999: " ! : :r!N)r r r __slots__rerrrr r!r"rrsUI,   ---:::::r!rcleZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdZdS)rrmcharacterStream stringDatarrrnrchd|_d|_d|_d|_d|_d|_d|_dSr(rr*s r"r,zDOMInputSource.__init__s8#    r!c|jSr(rmr*s r"_get_byteStreamzDOMInputSource._get_byteStream  r!c||_dSr(r)r+rms r"_set_byteStreamzDOMInputSource._set_byteStreams $r!c|jSr(rr*s r"_get_characterStreamz#DOMInputSource._get_characterStreams ##r!c||_dSr(r)r+rs r"_set_characterStreamz#DOMInputSource._set_characterStreams.r!c|jSr(rr*s r"_get_stringDatazDOMInputSource._get_stringDatarr!c||_dSr(r)r+datas r"_set_stringDatazDOMInputSource._set_stringDatas r!c|jSr(rr*s r" _get_encodingzDOMInputSource._get_encoding }r!c||_dSr(r)r+rs r" _set_encodingzDOMInputSource._set_encoding   r!c|jSr(rr*s r" _get_publicIdzDOMInputSource._get_publicId!rr!c||_dSr(r)r+rs r" _set_publicIdzDOMInputSource._set_publicId#rr!c|jSr(rnr*s r" _get_systemIdzDOMInputSource._get_systemId&rr!c||_dSr(r)r+rns r" _set_systemIdzDOMInputSource._set_systemId(rr!c|jSr(rr*s r" _get_baseURIzDOMInputSource._get_baseURI+s |r!c||_dSr(rr+rgs r" _set_baseURIzDOMInputSource._set_baseURI-s  r!N)r r r rr,rrrrrrrrrrrrrrr r!r"rrs@I%%%$$$///!!!!!!!!!r!rc@eZdZ dZdZdZdZejZ dZ dZ dZ dS) DOMBuilderFilterr r$r%r&c|jSr() whatToShowr*s r"_get_whatToShowz DOMBuilderFilter._get_whatToShowBrr!c|jSr( FILTER_ACCEPTr+elements r" acceptNodezDOMBuilderFilter.acceptNodeE !!r!c|jSr(rrs r"startContainerzDOMBuilderFilter.startContainerHrr!N) r r r r FILTER_REJECT FILTER_SKIPFILTER_INTERRUPTrSHOW_ALLrrrrr r!r"rr1seMMK$J""""""""r!rc8eZdZ dZdZdZdZdZdZdZ dS) DocumentLSFcdS)NFr r*s r" _get_asynczDocumentLS._get_asyncSsur!cH|rtjddS)Nz.asynchronous document loading is not supported)rCrDrE)r+flags r" _set_asynczDocumentLS._set_asyncVs7  B'))@BB B B Br!c td)Nz'haven't figured out what this means yetrxr*s r"abortzDocumentLS.abort[s" 577 7r!c tdNzhaven't written this yetrrs r"loadzDocumentLS.loada!"<===r!c tdrr)r+rs r"loadXMLzDocumentLS.loadXMLdrr!c||}n'|j|urtj|Sr() ownerDocumentrCrDWrongDocumentErrtoxml)r+snodes r"saveXMLzDocumentLS.saveXMLgs> =EE   , ,'**,, ,{{}}r!N) r r r async_rrrrrrr r!r"rrNsyG FBBB 777 >>>>>>r!rc(eZdZdZdZdZdZdZdS)DOMImplementationLSr r$c|tjd||jkrt S||jkrtjdt d)NzschemaType not yet supportedz'asynchronous builders are not supportedzunknown value for mode)rCrDrEMODE_SYNCHRONOUSrMODE_ASYNCHRONOUSrw)r+mode schemaTypes r"createDOMBuilderz$DOMImplementationLS.createDOMBuilderssw  !')).00 0 4( ( (<<  4) ) )'))9;; ;1222r!c td)Nz-the writer interface hasn't been written yet!rr*s r"createDOMWriterz#DOMImplementationLS.createDOMWriter~s! ;== =r!ctSr()rr*s r"createDOMInputSourcez(DOMImplementationLS.createDOMInputSourcesr!N)r r r r r r rrr r!r"rrosM 3 3 3===     r!r)rlxml.domrCxml.dom.NodeFilterr__all__rrr@objectrrrrrr r!r"rs: )))))) @ ? ?@a)a)a)a)a)a)a)a)H***):):):):):):):):X.....V...b""""""""4B          r!PKN\2dom/__pycache__/expatbuilder.cpython-311.opt-1.pycnu[ !A?h dZddlmZmZmZddlmZmZmZddlm Z ddl m Z m Z ddl mZejZejZejZejjZejjZejjZejjZejZejddejdd ejdd ejdd ejdd ejdd ejddejddejddd ZGddeZdZdZGddZeeefZ GddeZ!GddeZ"Gdde"Z#Gdde"Z$d Z%d!e%zZ&Gd"d#eZ'Gd$d%Z(Gd&d'e(eZ)Gd(d)e(e'Z*Gd*d+e+Z,Gd,d-eZ-d4d/Z.d4d0Z/d4d1Z0d4d2Z1d3Z2dS)5zFacility to use the Expat parser to load a minidom instance from a string or file. This avoids all the overhead of SAX and pulldom to gain performance. ) xmlbuilderminidomNode)EMPTY_NAMESPACE EMPTY_PREFIXXMLNS_NAMESPACE)expat) _append_child_set_attribute_node) NodeFilterNcdata enumerationentityentitiesididrefidrefsnmtokennmtokens) CDATAENUMENTITYENTITIESIDIDREFIDREFSNMTOKENNMTOKENScJeZdZdZd dZdZdZdZdZdZ d Z d Z d Z dS) ElementInfo _attr_info_modeltagNameNc0||_g|_||_dSN)r$r"r#)selfr$models A/opt/alt/python-internal/lib64/python3.11/xml/dom/expatbuilder.py__init__zElementInfo.__init__?s  c*|j|j|jfSr&r!r's r) __getstate__zElementInfo.__getstate__Ds T\99r+c0|\|_|_|_dSr&r!)r'states r) __setstate__zElementInfo.__setstate__Gs5:2dlllr+c|jD]F}|d|kr8|d}|ddkrtdcSt|dcSGtjS)Nr(r)r" _typeinfo_mapr_no_type)r'anameinfots r)getAttributeTypezElementInfo.getAttributeTypeJsnO 3 3DAw%HQ43;;(0000(b2222  r+ctjSr&)rr7)r' namespaceURI localNames r)getAttributeTypeNSzElementInfo.getAttributeTypeNSTs r+cv|jr1|jd}|tjjtjjfvSdSNrF)r#r r( XML_CTYPE_ANYXML_CTYPE_MIXED)r'types r)isElementContentzElementInfo.isElementContentWs? ; ;q>D 9 % ; == =5r+cT|jr |jdtjjkSdSrA)r#r r(XML_CTYPE_EMPTYr-s r)isEmptyzElementInfo.isEmpty_s' ; ;q>U[%@@ @5r+cN|jD]}|d|kr|ddkcSdS)Nr3r4rF)r")r'r8r9s r)isIdzElementInfo.isIdesAO ( (DAw%Bx4'''' ur+c0|||fSr&)rJ)r'eurienameaurir8s r)isIdNSzElementInfo.isIdNSksyy$'''r+r&) __name__ __module__ __qualname__ __slots__r*r.r1r;r?rErHrJrOr+r)r r <s1I :::;;;        (((((r+r c.|||Sr&)_intern_setdefault)builderss r)_internrYos  % %a + ++r+cd|d}|j}t|dkr2|\}}}|||}|d|}|||}|||}n@t|dkr|\}}t}|||x}}nt d|z||||||fS)N :z4Unsupported syntax: spaces in URIs not supported: %r)splitrVlenr ValueError)rWnamepartsinternuri localnameprefixqnames r)_parse_ns_namerirs JJsOOE  'F 5zzQ!&Y''!6699-ue$$F9i00 UqY"F9i888 ORVVWWW 6#s  Y 55r+ceZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdS) ExpatBuilderzPDocument builder that uses Expat to build a ParsedXML.DOM document instance.Nc|tj}||_|jjt |jj|_nd|_t |_d|_| dSr&) rOptions_optionsfilterFilterVisibilityController_filterr_finish_start_element_parserreset)r'optionss r)r*zExpatBuilder.__init__sf ? (**G =  +5dm6JKKDLLDL*,D &  r+c(tjS)zCreate a new parser object.)r ParserCreater-s r) createParserzExpatBuilder.createParsers!###r+c|jsm||_|jjj|_d|j_d|j_d|j_||j|jS)z7Return the parser object, creating a new one if needed.T) rsrxrd setdefaultrV buffer_textordered_attributesspecified_attributesinstallr-s r) getParserzExpatBuilder.getParsersi| ',,..DL&*l&9&DD #'+DL $.2DL +04DL - LL & & &|r+cttdd|_|j|_|jj|_d|_dS)z6Free all data structures used during DOM construction.NF)theDOMImplementationcreateDocumentrdocumentcurNode _elem_info_cdatar-s r)rtzExpatBuilder.resets@,;; T4)) } -2 r+c|j|_|j|_|j|_|j|_|jj r |j |_ |j |_ |jjr |j|_|jjr%|j|_|j|_|j|_n |j|_|j|_|j|_|j|_|j|_ dS)z>Install the callbacks needed to build the DOM into the parser.N)!start_doctype_decl_handlerStartDoctypeDeclHandlerfirst_element_handlerStartElementHandlerend_element_handlerEndElementHandler pi_handlerProcessingInstructionHandlerrnrentity_decl_handlerEntityDeclHandlernotation_decl_handlerNotationDeclHandlercommentscomment_handlerCommentHandlercdata_sectionsstart_cdata_section_handlerStartCdataSectionHandlerend_cdata_section_handlerEndCdataSectionHandlercharacter_data_handler_cdataCharacterDataHandlercharacter_data_handlerexternal_entity_ref_handlerExternalEntityRefHandlerxml_decl_handlerXmlDeclHandlerelement_decl_handlerElementDeclHandlerattlist_decl_handlerAttlistDeclHandlerr'parsers r)r~zExpatBuilder.installs*.)H&%)%?"#'#; .2o+ = ! @'+'?F $%)%?" = ! 9$($8F ! = ' F.2.NF +,0,JF )*.*KF ' '*.*EF '*.*J' $ 5$($=!$($=!!!r+cp|}d} |d}|sn<||d|r!|jjr||d}T|ddn#t $rYnwxYw|j}|d|_|S)zIParse a document from a file object, returning the document node.Tr3i@Fr+N) rreadParserdocumentElement _setup_subset ParseEscapertrs)r'filer first_bufferbufferdocs r) parseFilezExpatBuilder.parseFiles!!   %7++ VU+++/DM$A/&&v...$  % LLd # # # #    D m   sA+B BBc|} ||d||n#t$rYnwxYw|j}|d|_|S)zDL '48O 1 *4< *')D $ $ $ * * * *r+c|j||}t|j||jr?|j|t kr|j|dSdSdSr&)rcreateProcessingInstructionr rrqrr removeChild)r'targetdatanodes r)rzExpatBuilder.pi_handler s{}88FFdlD))) < +DL33D99]JJ L $ $T * * * * * + +JJr+c|jj}|jr\|jr3|djt kr|d|dS|j|}d|_nY|r1|djtkr|d}|j |z}||_ dStj }||_ |j|_ t|j|dS)NrT)rrr_cdata_continuenodeTypeCDATA_SECTION_NODE appendDatarcreateCDATASection TEXT_NODErrTextrr )r'rrrvalues r)rz)ExpatBuilder.character_data_handler_cdatas\, ; /&  n-1CCC2))$///=33D99D#'D  /JrN3y@@b>DI$EDI F<>>DDI!%D dlD)))))r+c|jj}|r/|djtkr|d}|j|z|_dSt j}|j|z|_|j|_t|j|dSr) rrrrrrrrrr )r'rrrs r)rz#ExpatBuilder.character_data_handler&s|\,  *R.1Y>>b>D D(DI F|~~I$ !]dlD)))))r+c|rdS|jjsdS|j||||}|4|j|} |j| |jjjj||j r<|j |tkr|jjjjd=dSdSdSr) rnrr_create_entitycreateTextNoderappendrrrqrr) r' entityNameis_parameter_entityrbaserr notationNamerchilds r)rz ExpatBuilder.entity_decl_handler1s   F}%  F}++J,4lDD  M0077E O " "5 ) ) ) &+224888 < 8DL33D99]JJ %.3B777 8 8JJr+c|j|||}|jjjj||jr<|j|tkr|jjjjd=dSdSdSr) r_create_notationrrrrrqr FILTER_ACCEPT)r'rrrrrs r)rz"ExpatBuilder.notation_decl_handlerCs}--lHhOO ',33D999 < 9DL33D99]JJ %/4R888 9 9JJr+c|j|}t|j||jr?|j|t kr|j|dSdSdSr&)r createCommentr rrqrrr)r'rrs r)rzExpatBuilder.comment_handlerIsy}**400dlD))) < +DL33D99]JJ L $ $T * * * * * + +JJr+c"d|_d|_dS)NTFrrr-s r)rz(ExpatBuilder.start_cdata_section_handlerOs $r+c"d|_d|_dS)NFrr-s r)rz&ExpatBuilder.end_cdata_section_handlerSs $r+cdSNr3rT)r'contextrrrs r)rz(ExpatBuilder.external_entity_ref_handlerWsqr+c|j|js t|_|j|_|||dSr&)rqrrrstart_element_handlerrr)r'rb attributess r)rz"ExpatBuilder.first_element_handlerZsJ <  ')D $/3/I, ""444444r+c|j|}t|j|||_|rvt dt |dD]W}t j||tdt}||dz}||_ |j|_ t||X||jj ur||dSdS)Nrr^r3)r createElementr rranger`rAttrrrrrr rrr)r'rbrriars r)rz"ExpatBuilder.start_element_handler`s}**400dlD)))  -1c*ooq11 - -LA!%|55"1Q3"&-#D!,,,, t}4 4 4  & &t , , , , , 5 4r+cP|jr||jjurdS|j|}|tkrt |n|t krt|ndS|j|_ |j || dSdSr&) rqrrstartContainerrRejecter FILTER_SKIPSkipper parentNoderrunlink)r'rfilts r)rrz"ExpatBuilder._finish_start_elementqs < t}444<..t44D}$$$$ ?DL O ' ' - - - KKMMMMM#  r+cV|j}|j|_||dSr&)rrr)r'rbrs r)rz ExpatBuilder.end_element_handlers-,)    )))))r+cL|j|j}|r||||jrc||jjurdS|j|tkr2|j || dSdSdSr&) rgetr$_handle_white_text_nodesrqrrrrrrr)r'rr9s r)rz ExpatBuilder._finish_end_elements""7?33  9  ) )'4 8 8 8 < !$-777|&&w//=@@ ((111      ! !A@r+c|jjs|sdSg}|jD]@}|jt kr.|js||A|D]}| |dSr&) rnwhitespace_in_element_contentrErrrrstriprr)r'rr9Lrs r)r z%ExpatBuilder._handle_white_text_nodess M 7 ((**  F _  E~**5:3C3C3E3E* $ $E   U # # # # $ $r+c|j|}|t|||j|<dS||_dSr&)rrr r#)r'rbr(r9s r)rz!ExpatBuilder.element_decl_handlersE""4(( <$/e$<$>>.,   :::OOO****+++ ***( * * *888$999 +++ %%%%%%555 ---".*** ! ! !$$$"   BBB11111r+rkcLeZdZdZdZdZdZdZej e j ej e j eje jeje jeje jeje jeje jeje jeje jeje jeje jej e j!i Z"dS)rpzoWrapper around a DOMBuilderFilter which implements the checks to make the whatToShow filter attribute work.roc||_dSr&r)r'ros r)r*z#FilterVisibilityController.__init__s  r+c|j|j}|jj|zrV|j|}|t krt |tvrtdt|z|StS)Nz)startContainer() returned illegal value: ) _nodetype_maskrro whatToShowrFILTER_INTERRUPTr_ALLOWED_FILTER_RETURNSrareprr)r'rmaskvals r)rz)FilterVisibilityController.startContainers"4=1 ; !D ( !+,,T22C&&&!!111 ADIIMOOOJ r+c~|j|j}|jj|zr|j|}|t krt |tkr5|j}|j ddD]}| |tS|tvrtdt|z|StS)Nz%acceptNode() returned illegal value: )rrrorrrrrrr appendChildrr rar!r)r'rr"r#parentrs r)rz%FilterVisibilityController.acceptNodes"4=1 ; !D ( !+((..C&&&!!k!!!_QQQ/..E&&u----$$111 =S IKKKJ r+N)#rPrQrRrrSr*rrr ELEMENT_NODEr SHOW_ELEMENTATTRIBUTE_NODESHOW_ATTRIBUTEr SHOW_TEXTrSHOW_CDATA_SECTIONENTITY_REFERENCE_NODESHOW_ENTITY_REFERENCE ENTITY_NODE SHOW_ENTITYPROCESSING_INSTRUCTION_NODESHOW_PROCESSING_INSTRUCTION COMMENT_NODE SHOW_COMMENT DOCUMENT_NODE SHOW_DOCUMENTDOCUMENT_TYPE_NODESHOW_DOCUMENT_TYPEDOCUMENT_FRAGMENT_NODESHOW_DOCUMENT_FRAGMENT NOTATION_NODE SHOW_NOTATIONrrTr+r)rprps55I ! ! !!!!* **A **C **> **G "**J **@ (**P **A **B **G #**K **B  NNNr+rpceZdZdZdZdS) FilterCrutch)_builder_level _old_start_old_endcd|_||_|j}|j|_|j|_|j|_|j|_dSr) r@r?rsrrArrBrr)r'rWrs r)r*zFilterCrutch.__init__sG   40 %)%?"#'#;   r+N)rPrQrRrSr*rTr+r)r>r>s(>I<<<<c$eZdZdZdZdZdZdS)rrTcvt|||j}dD]}t||ddS)N)rrrrrr)r>r*rssetattr)r'rWrrbs r)r*zRejecter.__init__sQdG,,, ( (D FD$ ' ' ' ' ( (r+c$|jdz|_dSr)r@r'argss r)rzRejecter.start_element_handlerskAo r+c|jdkr@|jj}|j||j|_|j|_dS|jdz |_dSNrr3)r@r?rsr~rArrBr)r'rIrs r)rzRejecter.end_element_handler sZ ;!  ]*F M ! !& ) ) ))-F &'+}F $ $ $+/DKKKr+N)rPrQrRrSr*rrrTr+r)rrsFI ( ( (&&&*****r+rceZdZdZdZdZdS)rrTcp|jj}|j||jj|ur|jdz|_dSdSr)r?rrAr@)r'rIrs r)rzSkipper.start_element_handler-sD}$ =  , ,+/DKKK - ,r+c|jdkr5|j|jj_|j|jj_d|_dS|jdz |_|j|dSrK)r@rAr?rsrrBrrHs r)rzSkipper.end_element_handler3s\ ;!  9=DM ! 56:mDM ! 3 DMMM+/DK DM4 r+N)rPrQrRrSrrrTr+r)rr*s7I*** ! ! ! ! !r+rz8http://xml.python.org/entities/fragment-builder/internalz %%s ]> &fragment-builder-internal;c>eZdZdZd dZdZdZdZdZdZ d Z dS) FragmentBuilderzBuilder which constructs document fragments given XML source text and a context node. The context node is expected to provide information about the namespace declarations which are in scope at the start of the fragment. Nc|jtkr||_||_n|j|_||_t ||dSr&)rr5originalDocumentrrrkr*)r'rrus r)r*zFragmentBuilder.__init__[sO  } , ,$+D !"DLL$+$9D !"DLdG,,,,,r+cHt|d|_dSr&)rkrtfragmentr-s r)rtzFragmentBuilder.resetds!4    r+cP||S)zRParse a document fragment from a file object, returning the fragment node.)rrr'rs r)rzFragmentBuilder.parseFilehs  ,,,r+c||_|}|jj}d}|rH|jp|}|jrd|jd|jd}n|jr d|jz}nd}|}t|||fz} | |dn#| xYw|j }| |S)zMParse a document fragment from a string, returning the fragment node.zPUBLIC "z" ""z SYSTEM "%s"T) _sourcerrRrr_getDeclarationsrr _getNSattrs_FRAGMENT_BUILDER_TEMPLATErrtrT) r'rrridentrnsattrsrrTs r)rzFragmentBuilder.parseStringms  !!'/  +Ft/D/D/F/FF 9 9#,,,g.>.>.>@! 9%(88F""$$-0HH  LL4 ( ( ( (  JJLLL = s B//Ccb|jjj}d}|rt|jjD]Y}|j|}|r|dz}|d|j}|jr|d|jd|j d}L|d|j d}Zt|j jD]}|j |}|r|dz}|d|j}|jr|d|jd|j d }n'|j r|d|j d }n|d |j j d }|j r |d |j }|d z}|S) zRe-create the internal subset from the DocumentType node. This is only needed if we don't already have the internalSubset as a string. rXz z z SYSTEM "z )rrrrrlengthitemnodeNamerrr firstChildrr)r'rrXrnotationrs r)r[z FragmentBuilder._getDeclarationss ,,4   7,344 C C",11!44#F A)*H,=,=>$C11h///1B1B1BDAA./QQ0A0A0ABAA7+233   )..q11#F A'(qq&//:?@11fooov@AA_@,-AAv?AA%&QQ(9(>(>(>?A&D,-AAv/B/BCAGr+cdS)NrXrTr-s r)r\zFragmentBuilder._getNSattrssrr+c|tkr|j}|j}|j|}|j|_|j|_|j|_ ||j d||_||_d|_ n#||_||_d|_ wxYwdSt |||||S)NTr) $_FRAGMENT_BUILDER_INTERNAL_SYSTEM_IDrrrsExternalEntityParserCreaterRcreateDocumentFragmentrTrrZrkr)r'rrrr old_document old_cur_noders r)rz+FragmentBuilder.external_entity_ref_handlers ; ; ; =Ltjd}d|_|S)z'Create a new namespace-handling parser.r[)namespace_separatorT)r rwnamespace_prefixesrs r)rxzNamespaces.createParsers"#<<<$(! r+cpt|||jjr|j|_dSdS)z.Insert the namespace-handlers onto the parser.N)rkr~rnnamespace_declarationsstart_namespace_decl_handlerStartNamespaceDeclHandlerrs r)r~zNamespaces.installsCT6*** = / 31  , , , 3 3r+c>|j||fdS)z/Push this namespace declaration on our storage.N)rqr)r'rgres r)rxz'Namespaces.start_namespace_decl_handlers# !((&#77777r+cd|vrt||\}}}}nt}|}d}t}tj||||}|j|_t|j|||_|j r|j D]y\}}|r.tj t|d|zt|d}n!tj dtdt}||_ |j|_t||z|j dd=|r||j} |j} t%dt'|dD]} || } || dz} d| vr9t|| \}}}}tj ||||}|| |<|| ||f<n2tj | t| t}|| | <|| t| f<|j|_| |_ ||_dSdS)Nr[xmlns:xmlnsrr^r3)rirrrElementrrr rrqrrYrrr _ensure_attributes_attrs_attrsNSrr` ownerElement)r'rbrrerfrgrhrrrrrr8rs r)rz Namespaces.start_element_handlers$ $;;,:4,F,F )CFEE!CEI!Fuc69==!]dlD)))  $ -#8 - - < WT8f3D%E%E%4fgGGAA Wo%,l<tT0J0J-Y#-DL  $ $W - - - - -r+N) rPrQrRrrrrxr~rxrrrTr+r)rorosfAA'''  333888-&-&-&^..r+roceZdZdZdZdS)ExpatBuilderNSz*Document builder that supports namespaces.cbt||dSr&)rkrtrrr-s r)rtzExpatBuilderNS.reset)s.4    r+N)rPrQrRrrtrTr+r)rr&s)44r+rceZdZdZdZdZdS)FragmentBuilderNSz*Fragment builder that supports namespaces.cbt||dSr&)rPrtrrr-s r)rtzFragmentBuilderNS.reset1s.d### r+cd}|j}g}|rst|drZ|jD]@\}}||vr |||rd|z}nd}|r |d|d|d}7d|d|d}A|j}|s|S) zNReturn string of namespace attributes from this element and ancestors.rX_ns_prefix_urir|r}z z=''r[)rhasattrritemsrr)r'attrsrr rgredeclnames r)r\zFragmentBuilderNS._getNSattrs5s,  )w 011 =#*#9#?#?#A#A = =KFC{{ HHV$$$+#+f#4#*=5:UUHHHccc J=/7hh <(G )  r+N)rPrQrRrrtr\rTr+r)rr.s844r+rceZdZdZdS)rzEException raised to short-circuit parsing in InternalSubsetExtractor.N)rPrQrRrrTr+r)rrSsOODr+rc@eZdZdZdZdZdZdZdZdZ dZ d Z dS) rzBXML processor which can rip out the internal document type subset.Nc|jS)z'Return the internal subset as a string.)rr-s r)rz!InternalSubsetExtractor.getSubset\s {r+c` t||dS#t$rYdSwxYwr&)rkrrrVs r)rz!InternalSubsetExtractor.parseFile`sE   " "4 . . . . .    DD   --c` t||dS#t$rYdSwxYwr&)rkrr)r'rs r)rz#InternalSubsetExtractor.parseStringfsE   $ $T6 2 2 2 2 2    DD rc6|j|_|j|_dSr&)rrrrrs r)r~zInternalSubsetExtractor.installls)-)H&%)%?"""r+c|r:|}g|_|jj|_|j|_dSt r&)rrrDefaultHandlerrrr)r'rbrrrrs r)rz2InternalSubsetExtractor.start_doctype_decl_handlerpsH  ^^%%FDK$(K$6F !+/+HF ( ( (-- r+cd|jdddd}||_t)NrXz   )joinrreplacer)r'rXs r)rz0InternalSubsetExtractor.end_doctype_decl_handlerzsF GGDK ( ( 6 6 > >tT J J mmr+ctr&)r)r'rbrs r)rz-InternalSubsetExtractor.start_element_handlers mmr+) rPrQrRrrrrrr~rrrrTr+r)rrWsLL F  @@@    r+rTc|rt}nt}t|tr>t |d5}||}dddn #1swxYwYn||}|S)z{Parse a document, returning the resulting Document node. 'file' may be either a file name or an open file object. rbN)rrk isinstancestropenr)r namespacesrWfpresults r)parsers ! ""..$) $   +&&r**F + + + + + + + + + + + + + + +""4(( MsA''A+.A+cj|rt}nt}||S)zOParse a document from a string, returning the resulting Document node. )rrkr)rrrWs r)rrs6! ""..   v & &&r+c|rt|}nt|}t|tr>t |d5}||}dddn #1swxYwYn||}|S)zParse a fragment of a document, given the context from which it was originally extracted. context should be the parent of the node(s) which are in the fragment. 'file' may be either a file name or an open file object. rN)rrPrrrr)rrrrWrrs r) parseFragmentrs+#G,,!'**$) $   +&&r**F + + + + + + + + + + + + + + +""4(( MsA))A-0A-cn|rt|}nt|}||S)zParse a fragment of a document from a string, given the context from which it was originally extracted. context should be the parent of the node(s) which are in the fragment. )rrPr)rrrrWs r)parseFragmentStringrs< +#G,,!'**   v & &&r+cL|jrt|St|S)z,Create a builder based on an Options object.)rrrk)rus r) makeBuilderrs)%g&&&G$$$r+)T)3rxml.domrrrrrr xml.parsersr xml.dom.minidomr r xml.dom.NodeFilterr rrr5DOMBuilderFilterrrrrgetDOMImplementationrTypeInfor6objectr rYrirkr rpr>rrrir]rProrr ExceptionrrrrrrrrTr+r)rsZ:.---------BBBBBBBBBB>>>>>>>>)))))) N ," +9 +9 )5 .?3w355! w//  }55  x00  z22  t,,  w//  x00  y11  z22   1(1(1(1(1(&1(1(1(f,,,666&|1|1|1|1|1|1|1|1B )-E7 7 7 7 7 7 7 7 t < < < < <6 < < <*****|***8!!!!!l!!!2?%*+ +r9r9r9r9r9lr9r9r9j\.\.\.\.\.\.\.\.~Z""""" O"""J     )   )))))l)))X$''''( ' ' ' '%%%%%r+PKN\ooRww'dom/__pycache__/minidom.cpython-311.pycnu[ !A?h, dZddlZddlZddlmZmZmZmZddlTddl m Z m Z ej j jej j jfZGddej j Z ee dd ee d d ee d d dZdZdZdZdZGdde ZGdde Zeedd eed d eedd GddeZeedd eZGd!d"eZeddZGd#d$e Zeed%d& eed d' d(ZGd)d*Z Gd+d,e e Z!Gd-d.e e Z"ee"dd/ Gd0d1e"Z#ee#d2d3 ee#d4d5 d6Z$d7Z%Gd8d9e"Z&Gd:d;e#Z'Gd<d=eZ(ee(dd> Gd?d@Z)GdAdBe)e e Z*GdCdDe)e Z+GdEdFe)e e Z,GdGdHe Z-GdIdJeZ.dKZ/GdLdMe e Z0ee0dNdO dPZ1dQZ2dRZ3dVdSZ4dWdTZ5dWdUZ6dS)XacSimple implementation of the Level 1 DOM. Namespaces and other minor Level 2 features are also supported. parse("foo.xml") parseString("") Todo: ===== * convenience methods for getting elements and text. * more testing * bring some of the writer and linearizer code into conformance with this interface * SAX 2 namespaces N)EMPTY_NAMESPACE EMPTY_PREFIXXMLNS_NAMESPACEdomreg)*)DOMImplementationLS DocumentLSceZdZdZdZdZdZdZeZ dZ ddZ ddZ dZ dZd Zd Zd Zd Zd ZdZdZdZdZdZdZdZdZdZdZdZdZdZ dS)NodeNcdS)NTselfs t jt|dt||j |j ||| |n |j |}n,#t$rt jwxYw|jt vrt#||j||||_||_|r|j|dz }||_||_nd|_||_ |S)N cannot be child of )r%DOCUMENT_FRAGMENT_NODEtupler0 insertBefore_child_node_typesxmldomHierarchyRequestErrrepr parentNode removeChild appendChildindex ValueError NotFoundErr_nodeTypes_with_children_clear_id_cacheinsert nextSiblingpreviousSibling)rnewChildrefChildcrKnodes rrBzNode.insertBeforeRs   ; ; ;8.// / /!!!X....O  D$: : :'--.28nnnnd4jjjIKK K   *   + +H 5 5 5     X & & & & ,--h77 , , ,g))+++ , $<<<%%% O " "5( 3 3 3#+H '/H $ 0uQw/#+ +/((+/("&H s C!!)D c|j|jkr.t|jD]}|||S|j|jvr>t jt|dt||jtvrt||j |j |t||d|_|SNr>)r%r@rAr0rJrCrDrErFrGrNrOrHrI _append_childrQ)rrVrUs rrJzNode.appendChildrs =D7 7 74?++ $ $  ####K = 6 6 6'--.24jjjj$t***EGG G ]6 6 6 D ! ! ! ? & O ' ' - - -dD!!! rc|j|jkr2|j}|||||S|j|jvr>t jt|dt|||urdS|j |j | |j |}n,#t$rt jwxYw||j |<||_ d|_ |jtvs|jtvrt!||j|_|j|_d|_d|_|jr ||j_|jr ||j_|SrX)r%r@rQrIrBrCrDrErFrGrHr0rKrLrMrNrOrR)rrSoldChildrTrKs r replaceChildzNode.replaceChilds   ; ; ;+H   X & & &$$Xx88 8  D$: : :'--.28nnnnd4jjjIKK K x   F   *   + +H 5 5 5 (O))(33EE ( ( ('%%'' ' (!)""  !9 9 9 $<<< D ! ! !'3#+#; ##'  # <3;H $ 0   <3;H 0s 7C)C;cZ |j|n,#t$rtjwxYw|j|j|j_|j|j|j_dx|_|_|jtvrt|d|_ |Sr.) r0removerLrDrErMrQrRr%rNrOrHrr[s rrIzNode.removeChilds ( O " "8 , , , , ( ( ('%%'' ' (   +3;3KH 0  # /3;3GH $ 0:>>x7   8 8 8 D ! ! !" )Aclg}|jD]}|jtjkr|jsA|r|j|d_|jr|j|j_|`|rf|dj|jkrP|d}|j|jz|_|j|_|jr ||j_||||||jtj kr| ||jdd<dSr:) r0r%r TEXT_NODEdatarQrRunlinkappend ELEMENT_NODE normalize)rLchildrVs rrgzNode.normalizes, _ & &E~//z$>,1,=")(RU^;;R5D $ EJ 6DI','8D$(A<@)9LLNNNNHHUOOOO>T%666OO%%%rc2t|||jp|Sr.) _clone_node ownerDocument)rdeeps r cloneNodezNode.cloneNodes4t'9'ATBBBrcB|jj||Sr.)rlimplementation hasFeaturerfeatureversions r isSupportedzNode.isSupporteds!0;;GWMMMrcdSr.r rs r_get_localNamezNode._get_localNamestrc ||uSr.r rothers r isSameNodezNode.isSameNodes u}rc6||dr|SdSr.)rurrss r getInterfacezNode.getInterfaces$   GT * * K4rcZ |j|dS#ttf$rYdSwxYwr7) _user_dataAttributeErrorKeyErrorrkeys r getUserDatazNode.getUserDatas@ ?3'* *)   44 s **cd} |j}n#t$r i}||_YnwxYw||vr||d}|d}|||=n||f||<|Sr7)rr)rrrchandleroldds r setUserDatazNode.setUserDatas AA   ADOOO  !88C&)C <GcFG_AcF s  ""ct|drJt|jD]%\}\}}|||||||$dSdS)Nr)hasattrlistritemshandle)r operationsrcdstrrcrs r_call_user_data_handlerzNode._call_user_data_handlers~ 4 & & C(,T_-B-B-D-D(E(E C C$_dG&NN9c4cBBB C C C Crcdx|_|_|jr1|jD]}|t |_d|_d|_dSr.)rHrlr0rdNodeListrRrQ)rris rrdz Node.unlinks\/33$, ? )   &jjDO#rc|Sr.r rs r __enter__zNode.__enter__s rc.|dSr.)rd)retevtbs r__exit__z Node.__exit__s rNN)rrNN)!__name__ __module__ __qualname__ namespaceURIrHrlrQrRrprefixrrrr1r4r8r<rBrJr\rIrgrnrurwr{r~rrrrdrrr rrr r "sLJMKO F>>>><@#....&%%%&&&'''@"@ 6CCCNNN  $CCC   rr firstChildzFirst child node, or None.)doc lastChildzLast child node, or None. localNamez"Namespace-local name of this node.c||j}|r|d}||_||_||||_dSr:)r0rRrQrerH)rrVr0lasts rrYrYsIJ "~#dDOOOrcJ| |jtjkrdS|j}| dSNTF)r%r r&rHrVs r _in_documentr's3   =D. . .4   5rc|ri|dddddddd}||d Sd S) zWrites datachars to writer.&z&z>N)replacewrite)r,rcs r _write_datar/so ||C))11#v>>GD(++GGC,@,@  Trc|jD]N}|jtjkr&|dks |j|kr||t |||O|SNr)r0r%r rftagNamere_get_elements_by_tagName_helper)parentnamercrVs rrr6sb!88 =D- - - S[[DLD00 IIdOOO'dB7777 Irc|jD]`}|jtjkrI|dks |j|kr&|dks |j|kr||t||||a|Sr)r0r%r rfrrre"_get_elements_by_tagName_ns_helper)rnsURIrrrVs rrr>s|!KK =D- - -c!!T^y%@%@#!2e!;!; $ .tUIr J J J IrceZdZejZdZdZdZdZ ej ej ej ej ejejejfZdZdS)DocumentFragmentz#document-fragmentNc,t|_dSr.)rr0rs r__init__zDocumentFragment.__init__Us"**r)rrrr r@r%nodeName nodeValue attributesrHrfrbCDATA_SECTION_NODEENTITY_REFERENCE_NODEPROCESSING_INSTRUCTION_NODE COMMENT_NODE NOTATION_NODErCrr rrrrGsp*H#HIJJ*039*+ -%%%%%rrceZdZdZejZdZdZdZ ej ej fZ e ddfdZdZdZdZdZeeexZZd Zd ZeeexZZd Zd ZeeeZd ZdZdZdS)Attr)_name_valuer_prefixr0 _localNamerl ownerElementNFcd|_||_||_||_|||_t |_|jtdSr.) rrrrrrr0reText)rqNamerrrs rrz Attr.__init__csZ  (  'DO"** tvv&&&&&rct |jS#t$r$|jdddcYSwxYwN:r?r;)rrrsplitrs rrwzAttr._get_localNamersM 3? " 3 3 3=&&sA..r2 2 2 2 3  +77c|jSr.) specifiedrs r_get_specifiedzAttr._get_specifiedx ~rc|jSr.)rrs r _get_namezAttr._get_name{ zrcN||_|jt|jdSdSr.)rrrOrvalues r _set_namezAttr._set_name~s1   ( D- . . . . . ) (rc|jSr.)rrs r _get_valuezAttr._get_value {rc||_||jd_|jt |j||jd_dSr7)rr0rcrrOrs r _set_valuezAttr._set_valuesG "'   ( D- . . ."'rc|jSr.)rrs r _get_prefixzAttr._get_prefix |rc|j}|dkr,|r*|tkrtjd||_||j}n |d|j}|jrt|j||_ dS)Nxmlnsz5illegal use of 'xmlns' prefix for the wrong namespacer) rrrDrE NamespaceErrrrrrOr)rrnsurinewNames r _set_prefixzAttr._set_prefixs! W   M/11g**KMMM >nGG!'8G   / D- . . . rc|j}|T|j|j=|j|j|jf=|jr,d|_|xjdzc_|jxj dzc_ |j D]}| |j dd=dS)NFr?) r_attrsr_attrsNSrr_is_id_magic_id_nodesrl_magic_id_countr0rd)relemris rrdz Attr.unlinks     DM* t0$.AB{ 8# $$)$$"22a722_  E LLNNNN OAAA   rc|jrdS|j}|j}||dS||}|dS|jr ||j|jS||jSr) rrlr_get_elem_inforisIdNSrisIdrrrrinfos r _get_isIdzAttr._get_isIds ; 4   ;$,5!!$'' <5   ,;;t0$.AA A99T]++ +rc|j}|j}||tS||}|tS|jr ||j|jS||jSr.) rlr_no_typerrgetAttributeTypeNSrgetAttributeTyperrs r_get_schemaTypezAttr._get_schemaTypesy   ;$,O!!$'' <O   8**4+tjt |dt ||j|j}|r| ||j|j<||j |j |j f<|j |_t|j|SrX)rrrDrErFrGrr(rrdrrrr rrO)rrVrs rr>zNamedNodeMap.setNamedItemas$%% G'--.24jjjj$t***EGG Gkoodi((   JJLLL!% DI=A t($.9: .)*** rc,||Sr.)r>rrVs rsetNamedItemNSzNamedNodeMap.setNamedItemNSns  &&&rcf||}t|j|dSr.)rOrrd)rr;rVs r __delitem__zNamedNodeMap.__delitem__qs/$%)*** rc*|j|j|jfSr.r rs r __getstate__zNamedNodeMap.__getstate__vs{DM4+===rc0|\|_|_|_dSr.r rstates r __setstate__zNamedNodeMap.__setstate__ys9>6 T]D$6$6$6rr.)!rrr__doc__rrrrrrr!rr$rr(__len__r,r/r2r4r7r9r<rArDrGrLrOr>rSrUrWr[r rrr r s8I***       ((( """$$$$$$,,,,GCCC %%%%%%$$$%%%$$$111 $ $ $  ( ( ( ( ( (   ''' >>>?????rr lengthz$Number of nodes in the NamedNodeMap.c*eZdZdZdZdZdZdZdS)TypeInfo namespacerc"||_||_dSr.ra)rrbrs rrzTypeInfo.__init__s" rc|jr d|jjd|jd|jdSd|jjd|jdS)Nr z (from z)>r)rb __class__rrrs r__repr__zTypeInfo.__repr__s` > D D*..*A*A*A4999*....: : D!% 7 7 7C Crc|jSr.)rrs rrzTypeInfo._get_name yrc|jSr.)rbrs r_get_namespacezTypeInfo._get_namespacerrN)rrrrrrgrrkr rrr`r`sX#IDDDrr`c&eZdZdZejZdZeZ dZ ejej ej ej ejejfZeddfdZdZdZdZdZd Zd Zd Zd Zd ZdZdZeZdZdZ dZ!e!Z"dZ#dZ$dZ%dZ&dZ'ddZ(dZ)dZ*dZ+dZ,dZ-dS) Element) rlrHrrrrrr0rrrQrRNrcd|_|x|_|_||_||_t |_dx|_|_d|_ d|_ dSr.) rHrrrrrr0rQrRrr)rrrrrs rrzElement.__init__sU'.. t} ("**2664/  rc4|ji|_i|_dSdSr.)rrrs r_ensure_attributeszElement._ensure_attributess$ ; DKDMMM  rct |jS#t$r$|jdddcYSwxYwr)rrrrrs rrwzElement._get_localNamesM 2? " 2 2 2<%%c1--b1 1 1 1 2rc|jSr.rrs r _get_tagNamezElement._get_tagNamerrc|j=t|jD]}|d|_d|_t |dSr.)rrrrdrr )rattrs rrdzElement.unlinksd ; "T[//1122      Drc\|jdS |j|jS#t$rYdSwxYw)aReturns the value of the specified attribute. Returns the value of the element's attribute named attname as a string. An empty string is returned if the element does not have such an attribute. Note that an empty string may also be returned as an explicitly given attribute value, use the hasAttribute method to distinguish these two cases. Nr)rrr)rr@s r getAttributezElement.getAttributesH ; 2 ;w'- -   22 s  ++c`|jdS |j||fjS#t$rYdSwxYwr)rrrrFs rgetAttributeNSzElement.getAttributeNSsK = 2 =, !:;A A   22 s  --c||}|9t|}||_|j|_||dS||jkr||_|jrt |dSdSdSr.)getAttributeNoderrrlsetAttributeNoderrO)rr@rrvs r setAttributezElement.setAttributes$$W-- <==DDJ!%!3D   ! !$ ' ' ' ' ' dj DJy &%%%%%!  & &rcXt|\}}|||}|t|||tSr.rrrFs rgetElementsByTagNameNSzElement.getElementsByTagNameNS`!1 , 8::77 7rc4d|jt|fzS)Nz)rr+rs rrgzElement.__repr__ds)T\2d88,DDDrrcB||dz|jz|}|D]J}|d|zt |||j|dK|jr|dt|jdkrN|jdjtj tj fvr$|jd |dddnO|||jD]}| |||z|||||d|jd|d S|d |zd S) zWrite an XML element to a file-like object Write the element to the writer object that must provide a write method (e.g. a file or StringIO object). rz %s="rrr?rrz%sN) rr_get_attributesrrrr0rr%r rbrr')rr,r* addindentr+ra_namerVs rr'zElement.writexmlgs  VCZ$,.///$$&&jjll  F LLF* + + + f 3 4 4 4 LL     ? ( LL   DO$$))"+(?0AAA"++FBB???? T""" OMMDMM&&*:ItLLLL V$$$ LLLdlllDD9 : : : : : LL ' ' ' ' 'rc`|t|j|j|Sr.)rpr rrrs rrzElement._get_attributess* !!!DK===rc|jrdSdSrrrs r hasAttributeszElement.hasAttributess ; 45rcZ||}||dSr.)r|setIdAttributeNode)rridAttrs rsetIdAttributezElement.setIdAttributes/&&t,, '''''rc\|||}||dSr.)rr)rrrrs rsetIdAttributeNSzElement.setIdAttributeNSs1((yAA '''''rc\|||jstjt |tj|js=d|_|xjdz c_|j xj dz c_ t|dSdS)NTr?) r{rrDrErM_get_containing_entrefNoModificationAllowedErrrrrlrrO)rrs rrzElement.setIdAttributeNodes >1D!E!E>'%%'' ' !$ ' ' 3'2244 4} " FM  A %   . .! 3 . . D ! ! ! ! !  " "rrrr).rrrrr rfr%rrr rrrrbrrrCrrrprwrtrdrxrzr~rr|rr}setAttributeNodeNSrrrremoveAttributeNodeNSrrrrrgr'rrrrrr rrrmrms1I HIJO*9*03 5.=T( 222   & & &..."))) <<< &*''''''   0###::: GGG777EEE((((@>>>(((((( " " " " "rrmrz*NamedNodeMap of attributes on the element.z%Namespace-local name of this element.ct||||j|j<||j|j|jf<||_dSr.)rOrprrrrrr)elementrvs rrrsWG    $GN49<@Gd'89  DrcfeZdZdZdZdZeZdZdZ dZ dZ dZ dZ dZd Zd Zd ZdS) ChildlesszMixin that makes childless-ness easy to implement and avoids the complexity of the Node methods that deal with children. r NcdSr.r rs rr8zChildless._get_firstChildrrcdSr.r rs rr<zChildless._get_lastChildrrcPtj|jdz)Nz nodes cannot have childrenrDrErFrrRs rrJzChildless.appendChild'g)) M9 9;; ;rcdSrr rs rr1zChildless.hasChildNodesurcPtj|jdzNz nodes do not have childrenrrrSrTs rrBzChildless.insertBeforerrcPtj|jdzr)rDrErMrr_s rrIzChildless.removeChilds'g!! M9 9;; ;rcdSr.r rs rrgzChildless.normalizes rcPtj|jdzrrrrSr[s rr\zChildless.replaceChildrr)rrrr\rr EmptyNodeListr0rrr8r<rJr1rBrIrgr\r rrrrsIJJJI;;;;;;;;;   ;;;;;rrcveZdZejZdZdZdZdZ e ee Z dZ dZ e e e Zd dZd S) ProcessingInstructiontargetrcc"||_||_dSr.r)rrrcs rrzProcessingInstruction.__init__s  rc|jSr.rcrs r_get_nodeValuez$ProcessingInstruction._get_nodeValuerirc||_dSr.rrs r_set_nodeValuez$ProcessingInstruction._set_nodeValues  rc|jSr.rrs r _get_nodeNamez#ProcessingInstruction._get_nodeNamerrc||_dSr.rrs r _set_nodeNamez#ProcessingInstruction._set_nodeNames  rrc Z||d|jd|jd|dS)Nz)rrrcrr,r*rr+s rr'zProcessingInstruction.writexmls5 t{{{DIIIttLMMMMMrNr)rrrr rr%rrrrrrrrrr'r rrrrs/H"I 88Ix }55HNNNNNNrrcneZdZdZdZdZeZdZdZe eexZ Z dZ dZ dZd Zd Zd Zd S) CharacterData)_datarlrHrRrQcdx|_|_dx|_|_d|_t |dSr)rlrHrRrQrr rrs rrzCharacterData.__init__s@/33T_266t/  drc*t|jSr.)rrcrs rrzCharacterData._get_length49~~rc|jSr.rrs r _get_datazCharacterData._get_datarrc||_dSr.rrrcs r _set_datazCharacterData._set_data s  rcz|j}t|dkrd}nd}d|jjd|dd|dS)N z...rz)rcrrfr)rrc dotdotdots rrgzCharacterData.__repr__sOy t99r>>III N # # #T!B$ZZ< > >..""y) $ 2 ? )rcrLrrs rr'zComment.writexmlsI 49  DEE E  44@AAAAArNr) rrrr rr%rrr'r rrrrsJ HHBBBBBBrrc,eZdZdZejZdZddZdS) CDATASectionr z#cdata-sectionrc|jddkrtd|d|jzdS)Nz]]>rz$']]>' not allowed in a CDATA sectionz)rcfindrLrrs rr'zCDATASection.writexmlsJ 9>>% A % %CDD D % 122222rNr) rrrrr rr%rr'r rrrrs:I&HH333333rrcbeZdZdZddZdZdZdZdZdZ d Z d Z d Z d Z d ZdZdZdS)ReadOnlySequentialNamedNodeMap_seqr c||_dSr.r)rseqs rrz'ReadOnlySequentialNamedNodeMap.__init__s  rc*t|jSr.rrrs rr]z&ReadOnlySequentialNamedNodeMap.__len__rrc*t|jSr.r rs rrz*ReadOnlySequentialNamedNodeMap._get_lengthrrc8|jD]}|j|kr|cSdSr.)rrrJs rrDz+ReadOnlySequentialNamedNodeMap.getNamedItems8  AzT!!"  rcN|jD]}|j|kr|j|kr|cSdSr.)rrrrNs rrGz-ReadOnlySequentialNamedNodeMap.getNamedItemNSs@  A~--!+2J2J  rct|tr |j|}n||}|t ||Sr.)rrArGrDr)r name_or_tuplerVs rr<z*ReadOnlySequentialNamedNodeMap.__getitem__sP mU + + 4&4& 6DD$$]33D <=)) ) rcP|dkrdS |j|S#t$rYdSwxYwr7)rrrs rrz#ReadOnlySequentialNamedNodeMap.itemsD 1994 9U# #   44 s  %%c@tjdNz"NamedNodeMap instance is read-onlyrDrErrCs rrLz.ReadOnlySequentialNamedNodeMap.removeNamedItemg.. 022 2rc@tjdr(r)rFs rrOz0ReadOnlySequentialNamedNodeMap.removeNamedItemNSr*rc@tjdr(r)rRs rr>z+ReadOnlySequentialNamedNodeMap.setNamedItemr*rc@tjdr(r)rRs rrSz-ReadOnlySequentialNamedNodeMap.setNamedItemNSr*rc|jgSr.rrs rrWz+ReadOnlySequentialNamedNodeMap.__getstate__s  {rc |d|_dSr7rrYs rr[z+ReadOnlySequentialNamedNodeMap.__setstate__s!H rN)r )rrrrrr]rrDrGr<rrLrOr>rSrWr[r rrrrsI  222222222222rrz&Number of entries in the NamedNodeMap.c(eZdZdZdZdZdZdZdS) Identifiedz@Mix-in class that supports the publicId and systemId attributes.publicIdsystemIdc"||_||_dSr.r2)rr3r4s r_identified_mixin_initz!Identified._identified_mixin_inits    rc|jSr.)r3rs r _get_publicIdzIdentified._get_publicId }rc|jSr.)r4rs r _get_systemIdzIdentified._get_systemIdr9rN)rrrr\rr6r8r;r rrr1r1 sLJJ&I!!!rr1cJeZdZejZdZdZdZdZ dZ dZ dZ dZ ddZdS) DocumentTypeNct|_t|_|rt|\}}||_|j|_dSr.)rentities notationsrrr)rrrrs rrzDocumentType.__init__$sJ688 799  " ( 7 7 FI!DI  rc|jSr.)internalSubsetrs r_get_internalSubsetz DocumentType._get_internalSubset, ""rc|jetd}|j|_|j|_tjjj}|r g|j_ g|j _ |j j D]X}t|j|j |j }|j j |||||Y|jj D]}t!|j|j |j |j}|j|_|j|_|j|_|jj ||||||||||SdSr.)rlr=rrrDrEUserDataHandler NODE_CLONEDr?rr@Notationr3r4rerEntity notationNameactualEncodingrrt)rrmclonerrKnotationeentitys rrnzDocumentType.cloneNode/s^   % &&EEJ!YEN/;I D&(#')$,FFA' AJ KKHO(//999--iHEEEE+DDA#AJ AJ$%N44F,-,@@@)), FFG )((( OOG $ $ $  =9< r9rc|jSr.) errorHandlerrs r_get_errorHandlerzDocument._get_errorHandlerAs   rc|jSr.)rrs r_get_standalonezDocument._get_standaloneDr5rc|jSr.)strictErrorCheckingrs r_get_strictErrorCheckingz!Document._get_strictErrorCheckingGs ''rc|jSr.r]rs rr^zDocument._get_versionJrrc|j|jvr>tjt |dt ||j|j||jtj kr3| rtjdt ||S)Nr>z two document elements disallowed) r%rCrDrErFrGrHrIr rf_get_documentElementrJrRs rrJzDocument.appendChildMs = 6 6 6'--.24jjjj$t***EGG G ? & O ' ' - - - =D- - -((** .'--244 4d+++rc |j|n,#t$rtjwxYwdx|_|_d|_|j |urd|_ |Sr.) r0r^rLrDrErMrQrRrHdocumentElementr_s rrIzDocument.removeChild]s ( O " "8 , , , , ( ( ('%%'' ' (:>>x7"  8 + +#'D r`cL|jD]}|jtjkr|cSdSr.)r0r%r rfrRs rrzDocument._get_documentElementis;O  D} 111 2  rc|j |jd|_t|dSr.)rurdr rs rrdzDocument.unlinkns= < # L   ! ! !DL Drc|sdS|jddd}|j|_|j|_|j|_|jD]}t |||}|j|sJ|j ||j tj kr |j Jn%|j tjkr|jJ||_||_|t$jjj|||Sr.)rprwrrrtr0rkrlr{rer%r r&rrSrurHrrDrErFrG)rrmrLrK childclones rrnzDocument.cloneNodets 4#224tDD?   * *A$Qe44J+66u== = ==   # #J / / /"d&888,4444$(???},,, * $)J ! ! $$SW%<%H%)5 2 2 2 rc0t}||_|Sr.)rrl)rrs rcreateDocumentFragmentzDocument.createDocumentFragments   rc2t|}||_|Sr.)rmrl)rrrNs r createElementzDocument.createElements G  rct|tstdt}||_||_|SNznode contents must be a string)rr r?rrcrl)rrcts rcreateTextNodezDocument.createTextNodes?$$$ ><== = FFrct|tstdt}||_||_|Sr)rr r?rrcrlrrcrUs rcreateCDATASectionzDocument.createCDATASections?$$$ ><== = NNrc2t|}||_|Sr.)rrlrs r createCommentzDocument.createComments DMMrc4t||}||_|Sr.)rrl)rrrcps rcreateProcessingInstructionz$Document.createProcessingInstructions !&$ / /rc@t|}||_d|_|Sr)rrlr)rras rcreateAttributezDocument.createAttributes KKrcZt|\}}t|||}||_|Sr.)rrmrl)rrrrrrNs rrtzDocument.createElementNSs1$]33 M< 8 8rcjt|\}}t||||}||_d|_|Sr)rrrlr)rrrrrrs rcreateAttributeNSzDocument.createAttributeNSs:$]33  i @ @rc8t||||}||_|Sr.)rIrl)rrr3r4rJrNs r_create_entityzDocument._create_entitys! 48\ : :rc6t|||}||_|Sr.)rHrl)rrr3r4rKs r_create_notationzDocument._create_notations T8X . .rc||jvr |j|S|js |jsdS|j}||jg}||_n|sdSd}|rx|}|d|jD||}|r|j D]}|j rG| |j |j r&||j|j<|j|kr|}F|jsntP||jr'||j|j<|j|kr|}|jsn3|jr*||j|j<|j|kr|}|jdkrnnF|jr?|j D]%}|jr||j|j<|j|kr|}&|n|x|S)Nc.g|]}|jtv|Sr )r%rN).0ris r z+Document.getElementById..s2IIIE"^/GGG GGGrr?)rrrrrpopextendr0rrrrrrrrrrr)rr+stackresultrVrrvs rgetElementByIdzDocument.getElementByIdsN   >"% % 4#7 4% =)*E$)D ! ! 4& 99;;D LLIIT_III J J J&&t,,D *!O2244""D(";;t'8$.II&9=DN4:6#zR//)-%)%9& %49-- "59tz2:++%)FF!%!5"!E""59tz2:++%)FF!1Q66!E% * O2244**D{*59tz2:++%)F!M& N rc<t||tSr.rrCs rrzDocument.getElementsByTagNames.tT8::FFFrc>t|||tSr.rrFs rrzDocument.getElementsByTagNameNS rrc8|j||Sr.)rprqrrs rruzDocument.isSupporteds"--gw???rc|jtjkrtjd|jtjkrtjdt|||S)Nzcannot import document nodesz!cannot import document type nodes)r%r r&rDrENotSupportedErrrSrk)rrVrms r importNodezDocument.importNodesb =D. . .'))*HII I ]d5 5 5'))*MNN N4t,,,rrcg}|r|d|d||d|rdndd|dd|d||jD]}|||||dS) Nz encoding="rz standalone="yesnoz@@@ FI :, , ,nG"++A...G  % :* * *AIIAF"((+++2..q111 r)rrrNN)=rrrrr rfrrrSrCrhrpr&r%rrrrHrRrQrKrrrtrrrrrrrXrrr[rrrr^rJrIrrdrnrrrrrrrrtrrrrrrrurr'rr rrr|r| s@I*D,L*D,CE'&((N!HHIJJ$((Ok NHJGLKO%%%(((###   !!!(((,,,     *        888tGGG777@@@---KO  ; ; ; ; 33333rr|rz#Top-level element of this document.c |j|rtjjj}ntjjj}|jtj kr| |j |j }|j D]T}||j |j |j||j |j}|j|_U|r0|jD](}t+|||}||)nG|jtjkrH|}|r0|jD](}t+|||}||)n|jtjkr||j}n|jtjkr||j}n|jtjkr"||j |j}nQ|jtj!kr|"|j}n |jtj#kr5|$|j |j }d|_|j|_n|jtj%kr|j|usJtjjj}|j&'|j(|j)|j*}||_|r:g|j+_,g|j-_,|j-j,D]o} t]| j | j)| j*} || _|j-j,/| ta| dr| 1|| | p|j+j,D]} te| j | j)| j*| j3} | j4| _4| j5| _5| j6| _6|| _|j+j,/| ta| dr| 1|| | n/tj7dtq|zta|dr|1||||S)zo Clone a node and give it the new owner document. Called by Node.cloneNode and Document.importNode TrzCannot clone node %s)9rlr{rDrErFrG NODE_IMPORTEDr%r rfrtrrrrrrrrrr0rkrJr@rrbrrcrrrrrrrrrrSrpryrr3r4r?rr@rHrerrrIrJrKrrtrrG) rVrmnewOwnerDocumentrrLrvrrirUrKrMrNrOs rrkrkasK  $$%566:G+7 G+9  }))) 001B15@@O**,, ) )D  !2DM4: N N N(():DNKKA.AKK  % % %t-=>>!!!$$$$ $5 5 5 7799  % % %t-=>>!!!$$$$ $. ( ( // :: $1 1 1 33DI>> $: : : <3H==H  DAq*55a;; tt   ""rrr.)7r\r!rrDrrrrxml.dom.minicompatxml.dom.xmlbuilderrr rEr rfrrN defpropertyrYrrrrrrobjectr  AttributeListr`rrmrrrrrr rrrrr1r=rIrHrhr~rOr|rkrrrrrr rrrs" JJJJJJJJJJJJ >>>>>>>> GL5GL>@ttttt37<tttl D,$@AAAA D+$?@@@@ D+$HIIII%%%%%t%%%$y8y8y8y8y84y8y8y8v D&$FGGGG D+$MNNNN D,$EFFFFa?a?a?a?a?6a?a?a?F L(68888 v( 8D$  L"L"L"L"L"dL"L"L"\ G\<>>>> G[79999    &;&;&;&;&;&;&;&;RNNNNNItNNN4ECECECECECItECECECN M8)EFFFFS+S+S+S+S+=S+S+S+j D0.//// D+@BBBB B B B B Bm B B B 3 3 3 3 34 3 3 3<<<<<V<<<| *H8::::        ::::::y$:::x&9&9&9&9&9Z&9&9&9P88888z9d888MMMMM+MMM^(((((&(((T222QQQQQtZQQQf  H'57777OOOd!!!44445555######rPKN\~GG-dom/__pycache__/pulldom.cpython-311.opt-1.pycnu[ !A?hu-ddlZddlZdZdZdZdZdZdZdZ d Z Gd d ej j Z Gd d ZGddZGdde ZdZddZddZdS)N START_ELEMENT END_ELEMENTCOMMENTSTART_DOCUMENT END_DOCUMENTPROCESSING_INSTRUCTIONIGNORABLE_WHITESPACE CHARACTERSc~eZdZdZdZddZdZdZdZdZ dZ dZ d Z d Z d Zd Zd ZdZdZdZdZdZdS)PullDOMNcddlm}||_ddg|_|j|_g|_|jj|_ |jj|_n#t$rYnwxYw|dig|_ |j d|_ g|_ dS)Nr) XML_NAMESPACExml) xml.domrdocumentFactory firstEvent lastEvent elementStackappendpushpopAttributeError _ns_contexts_current_contextpending_events)selfrrs >>%+^tc"""r#cB|j|_dSr%)rrr)rr.s rendPrefixMappingzPullDOM.endPrefixMapping0s $ 1 5 5 7 7r#cd}t|dd}||D]\}}||j||f<g|_|\}} |rV||j|} | r | dz| z}n| }|jr|j||} nO|||} n8|jr|j| } n|d| } |D]\}}|\} } | |kr?| dkr| }nd| z}|j | |}| |n|| rK|j| } | r | dz| z}n| }|j | |}| |n/|j | }| |||_ t| fdg|jd<|jd|_|| dS)Nzhttp://www.w3.org/2000/xmlns/r*:r+zxmlns:)getattr_attrsr*rdocumentcreateElementNS buildDocument createElementitemscreateAttributeNSsetAttributeNodeNScreateAttributesetAttributeNodevaluerrr)rnametagNameattrs xmlns_uri xmlns_attrsanamerAr/ localnamer.nodea_uri a_localnameqnameattrs rstartElementNSzPullDOM.startElementNS3sD3 dND99  " + 9 9 u38 i/00 "D Y  ;.s3($slY6GG'G} 8}44S'BB))#w77} ;}229==))$ :: ;;==  KE%!& E; !!'))'EE${2E}66ueDD''---- ,.u5("SL;6EE'E}66ueDD''----}44[AA%%d+++DJJ+T2D9q* $r#ctt|fdg|jd<|jd|_dSNr5rrr)rrBrCs r endElementNSzPullDOM.endElementNSl2)488::6=q*r#c|jr|j|}n|d|}|D];\}}|j|}||_||sc!"C(("&--! '$$&& &&' 2 22r#cddlm}t|}||}|stj}t |||S)Nr)StringIO)iorlenrrrr)stringrrrrs r parseStringrIs[&kkG (6  C '$$&& #vw / //r#)NNr%)xml.saxrxml.sax.handlerrrrrrrr r rContentHandlerr rrrrrrrr#rrs9  ! 1-  uuuuucg$uuunMMMMMMMM^%%%%%g%%%B! 3 3 3 3000000r#PKN\k ,dom/__pycache__/domreg.cpython-311.opt-2.pycnu[ !A?h{ 8 ddlZdddZiZdZdZd dZd ZdS) Nzxml.dom.minidomzxml.dom.DOMImplementation)minidom4DOMc |t|<dS)N) registered)namefactorys ;/opt/alt/python-internal/lib64/python3.11/xml/dom/domreg.pyregisterDOMImplementationr sJtcJ |D]\}}|||sdSdS)Nr) hasFeature)domfeaturesfvs r _good_enoughr s?L!~~a"" 11  1r c ddl}d}t|}|r't|iidg}|S|rt |St jjs$d|j vrt |j dSt|trt|}t D] }|}t||r|cS!tD]8} t |}n#t $rY wxYwt||r|cS9t#d)NrgetDOMImplementation PYTHON_DOM)rz$no suitable DOM implementation found)oswell_known_implementationsget __import__rrsysflagsignore_environmentenviron isinstancestr_parse_feature_stringvaluesrkeys Exception ImportError)rrrcreatormodrs r rr's CIIIG $ ( ( . .C Eb"'=&>??''))) E$!!! Y )Elbj.H.H#2:l+CDDDD(C  3(22$$&&gii X & & JJJ .2244 &g666CC    H  X & & JJJ  < = ==sD!! D.-D.cHg}|}d}t|}||krg||}|ddvrtd||dz}d}||kr||}|ddvr|dz}|}|||f||kgt |S)Nr 0123456789zbad feature name: r )splitlen ValueErrorappendtuple)srpartsilengthfeatureversionrs r r"r"RsH GGIIE A ZZF f**( 1: % %*ww@AA A E v::aAt|##E'*+++ f** ??r )Nr)rrrr rrr"rr r r6s}>  '       )>)>)>)>Vr PKN\~GG'dom/__pycache__/pulldom.cpython-311.pycnu[ !A?hu-ddlZddlZdZdZdZdZdZdZdZ d Z Gd d ej j Z Gd d ZGddZGdde ZdZddZddZdS)N START_ELEMENT END_ELEMENTCOMMENTSTART_DOCUMENT END_DOCUMENTPROCESSING_INSTRUCTIONIGNORABLE_WHITESPACE CHARACTERSc~eZdZdZdZddZdZdZdZdZ dZ dZ d Z d Z d Zd Zd ZdZdZdZdZdZdS)PullDOMNcddlm}||_ddg|_|j|_g|_|jj|_ |jj|_n#t$rYnwxYw|dig|_ |j d|_ g|_ dS)Nr) XML_NAMESPACExml) xml.domrdocumentFactory firstEvent lastEvent elementStackappendpushpopAttributeError _ns_contexts_current_contextpending_events)selfrrs >>%+^tc"""r#cB|j|_dSr%)rrr)rr.s rendPrefixMappingzPullDOM.endPrefixMapping0s $ 1 5 5 7 7r#cd}t|dd}||D]\}}||j||f<g|_|\}} |rV||j|} | r | dz| z}n| }|jr|j||} nO|||} n8|jr|j| } n|d| } |D]\}}|\} } | |kr?| dkr| }nd| z}|j | |}| |n|| rK|j| } | r | dz| z}n| }|j | |}| |n/|j | }| |||_ t| fdg|jd<|jd|_|| dS)Nzhttp://www.w3.org/2000/xmlns/r*:r+zxmlns:)getattr_attrsr*rdocumentcreateElementNS buildDocument createElementitemscreateAttributeNSsetAttributeNodeNScreateAttributesetAttributeNodevaluerrr)rnametagNameattrs xmlns_uri xmlns_attrsanamerAr/ localnamer.nodea_uri a_localnameqnameattrs rstartElementNSzPullDOM.startElementNS3sD3 dND99  " + 9 9 u38 i/00 "D Y  ;.s3($slY6GG'G} 8}44S'BB))#w77} ;}229==))$ :: ;;==  KE%!& E; !!'))'EE${2E}66ueDD''---- ,.u5("SL;6EE'E}66ueDD''----}44[AA%%d+++DJJ+T2D9q* $r#ctt|fdg|jd<|jd|_dSNr5rrr)rrBrCs r endElementNSzPullDOM.endElementNSl2)488::6=q*r#c|jr|j|}n|d|}|D];\}}|j|}||_||sc!"C(("&--! '$$&& &&' 2 22r#cddlm}t|}||}|stj}t |||S)Nr)StringIO)iorlenrrrr)stringrrrrs r parseStringrIs[&kkG (6  C '$$&& #vw / //r#)NNr%)xml.saxrxml.sax.handlerrrrrrrr r rContentHandlerr rrrrrrrr#rrs9  ! 1-  uuuuucg$uuunMMMMMMMM^%%%%%g%%%B! 3 3 3 3000000r#PKN\⍀NN*dom/__pycache__/minicompat.cpython-311.pycnu[ !A?h' ^dZgdZddlZefZGddeZGddeZ dZ dS) zPython version compatibility support for minidom. This module contains internal implementation details and should not be imported; use xml.dom.minidom instead. )NodeList EmptyNodeList StringTypes defpropertyNcFeZdZdZdZdZdZeeedZdZ dS) rcRd|cxkrt|kr ndS||SdSNrlenselfindexs ?/opt/alt/python-internal/lib64/python3.11/xml/dom/minicompat.pyitemz NodeList.item5s?  ! ! ! !D ! ! ! ! ! !;  " !c t|SNr rs r _get_lengthzNodeList._get_length9s4yyrc@tjdNz.attempt to modify read-only attribute 'length'xmldomNoModificationAllowedErrrvalues r _set_lengthzNodeList._set_length<g.. <>> >r$The number of nodes in the NodeList.docc|g}||dd<dSrr)rstates r __setstate__zNodeList.__setstate__Ds =EQQQrN) __name__ __module__ __qualname__ __slots__rrrpropertylengthr&rrrrr2swI>>>Xk;@BBBFrrcLeZdZdZdZdZdZdZdZe eedZ d S) rrcLt}|||SrrextendrotherNLs r__add__zEmptyNodeList.__add__M" ZZ % rcLt}|||Srr/r1s r__radd__zEmptyNodeList.__radd__Rr5rcdSrrr s rrzEmptyNodeList.itemWstrcdSr rrs rrzEmptyNodeList._get_lengthZsqrc@tjdrrrs rrzEmptyNodeList._set_length]r rr!r"N) r'r(r)r*r4r7rrrr+r,rrrrrJsI  >>>Xk;@BBBFFFrrct|d|z}|fd}t|d|zr Jd|zt|||}t|||dS)N_get_c`tjdt|z)Nz&attempt to modify read-only attribute )rrrrepr)rrnames rsetzdefproperty..setgs-g.. 4tDzz ACC Cr_set_zexpected not to find _set_r")getattrhasattrr+setattr)klassr?r#getr@props rrres %'D. * *C"CCCCugn--// '$ .// - C# & & &D E4r) __doc____all__xml.domrstrrlistrtuplerrrrrrNsT F E Ef t0BBBBBEBBB6rPKN\s(dom/__pycache__/__init__.cpython-311.pycnu[ !A?h~dZGddZdZdZdZdZdZdZd Zd Z d Z d Z d Z dZ dZdZdZdZGddeZGddeZGddeZGddeZGddeZGddeZGdd eZGd!d"eZGd#d$eZGd%d&eZGd'd(eZGd)d*eZGd+d,eZGd-d.eZ Gd/d0eZ!Gd1d2eZ"Gd3d4eZ#Gd5d6Z$d7Z%d8Z&d9Z'd:Z(d:Z)dd;l*m+Z+m,Z,d:S)\ ) )BDD D4-$---"-----r"c|jS)N)code)r/s r# _get_codezDOMException._get_codeHs yr"N)rrrrr.r4rr"r#r)r)>s>II... r"r)ceZdZeZdS) IndexSizeErrN)rrrINDEX_SIZE_ERRr3rr"r#r6r6L DDDr"r6ceZdZeZdS)DomstringSizeErrN)rrrDOMSTRING_SIZE_ERRr3rr"r#r:r:O DDDr"r:ceZdZeZdS)HierarchyRequestErrN)rrrHIERARCHY_REQUEST_ERRr3rr"r#r>r>R DDDr"r>ceZdZeZdS)WrongDocumentErrN)rrrWRONG_DOCUMENT_ERRr3rr"r#rBrBUr<r"rBceZdZeZdS)InvalidCharacterErrN)rrrINVALID_CHARACTER_ERRr3rr"r#rErEXr@r"rEceZdZeZdS)NoDataAllowedErrN)rrrNO_DATA_ALLOWED_ERRr3rr"r#rHrH[ DDDr"rHceZdZeZdS)NoModificationAllowedErrN)rrrNO_MODIFICATION_ALLOWED_ERRr3rr"r#rLrL^s &DDDr"rLceZdZeZdS) NotFoundErrN)rrr NOT_FOUND_ERRr3rr"r#rOrOa DDDr"rOceZdZeZdS)NotSupportedErrN)rrrNOT_SUPPORTED_ERRr3rr"r#rSrSd DDDr"rSceZdZeZdS)InuseAttributeErrN)rrrINUSE_ATTRIBUTE_ERRr3rr"r#rWrWgrJr"rWceZdZeZdS)InvalidStateErrN)rrrINVALID_STATE_ERRr3rr"r#rZrZjrUr"rZceZdZeZdS) SyntaxErrN)rrr SYNTAX_ERRr3rr"r#r]r]ms DDDr"r]ceZdZeZdS)InvalidModificationErrN)rrrINVALID_MODIFICATION_ERRr3rr"r#r`r`ps #DDDr"r`ceZdZeZdS) NamespaceErrN)rrr NAMESPACE_ERRr3rr"r#rcrcsrQr"rcceZdZeZdS)InvalidAccessErrN)rrrINVALID_ACCESS_ERRr3rr"r#rfrfvr<r"rfceZdZeZdS) ValidationErrN)rrrVALIDATION_ERRr3rr"r#ririyr8r"ric"eZdZdZdZdZdZdZdS)UserDataHandlerzBClass giving the operation constants for UserDataHandler.handle().rrrrN)rrrr NODE_CLONED NODE_IMPORTED NODE_DELETED NODE_RENAMEDrr"r#rlrl|s*LLKMLLLLr"rlz$http://www.w3.org/XML/1998/namespacezhttp://www.w3.org/2000/xmlns/zhttp://www.w3.org/1999/xhtmlN)getDOMImplementationregisterDOMImplementation)-rrr7r;r?rCrFrIrMrPrTrXr[r^rardrgrjr-r)r6r:r>rBrErHrLrOrSrWrZr]r`rcrfrirl XML_NAMESPACEXMLNS_NAMESPACEXHTML_NAMESPACEEMPTY_NAMESPACE EMPTY_PREFIXdomregrqrrrr"r#rys"%%%%%%%%4"#!"!"!"!"!"!"!" !"!#!#!# !#!# !#!#     9   <|!!!!!,!!!|!!!!!,!!!|'''''|''',l l $$$$$\$$$<|L7 10 CCCCCCCCCCr"PKN\nxۑ0dom/__pycache__/NodeFilter.cpython-311.opt-1.pycnu[ !A?h GddZdS)cXeZdZdZdZdZdZdZdZdZ dZ dZ dZ d Z d Zd Zd Zd ZdZdZdZdS) NodeFilterzL This is the DOM2 NodeFilter interface. It contains only constants. l @iiict)N)NotImplementedError)selfnodes ?/opt/alt/python-internal/lib64/python3.11/xml/dom/NodeFilter.py acceptNodezNodeFilter.acceptNodes!!N)__name__ __module__ __qualname____doc__ FILTER_ACCEPT FILTER_REJECT FILTER_SKIPSHOW_ALL SHOW_ELEMENTSHOW_ATTRIBUTE SHOW_TEXTSHOW_CDATA_SECTIONSHOW_ENTITY_REFERENCE SHOW_ENTITYSHOW_PROCESSING_INSTRUCTION SHOW_COMMENT SHOW_DOCUMENTSHOW_DOCUMENT_TYPESHOW_DOCUMENT_FRAGMENT SHOW_NOTATIONrrrrrsMMK",H",L",N",I",",",K",",L",M",",",M"""""rrN)rr)rrr*s7""""""""""rPKN\d^0",dom/__pycache__/domreg.cpython-311.opt-1.pycnu[ !A?h{ :dZddlZdddZiZdZdZd d Zd ZdS) zRegistration facilities for DOM. This module should not be used directly. Instead, the functions getDOMImplementation and registerDOMImplementation should be imported from xml.dom.Nzxml.dom.minidomzxml.dom.DOMImplementation)minidom4DOMc|t|<dS)aIregisterDOMImplementation(name, factory) Register the factory function with the name. The factory function should return an object which implements the DOMImplementation interface. The factory function can either return the same object, or a new one (e.g. if that implementation supports some customization).N) registered)namefactorys ;/opt/alt/python-internal/lib64/python3.11/xml/dom/domreg.pyregisterDOMImplementationr sJtcH|D]\}}|||sdSdS)zF_good_enough(dom, features) -> Return 1 if the dom offers the featuresr) hasFeature)domfeaturesfvs r _good_enoughr s<!~~a"" 11  1r cddl}d}t|}|r't|iidg}|S|rt |St jjs$d|j vrt |j dSt|trt|}t D] }|}t||r|cS!tD]8} t |}n#t $rY wxYwt||r|cS9t#d)aSgetDOMImplementation(name = None, features = ()) -> DOM implementation. Return a suitable DOM implementation. The name is either well-known, the module name of a DOM implementation, or None. If it is not None, imports the corresponding module and returns DOMImplementation object if the import succeeds. If name is not given, consider the available implementations to find one with the required feature set. If no implementation can be found, raise an ImportError. The features list must be a sequence of (feature, version) pairs which are passed to hasFeature.rNgetDOMImplementation PYTHON_DOM)rz$no suitable DOM implementation found)oswell_known_implementationsget __import__rrsysflagsignore_environmentenviron isinstancestr_parse_feature_stringvaluesrkeys Exception ImportError)rrrcreatormodrs r rr'sIIIG $ ( ( . .C Eb"'=&>??''))) E$!!! Y )Elbj.H.H#2:l+CDDDD(C  3(22$$&&gii X & & JJJ .2244 &g666CC    H  X & & JJJ  < = ==sD  D-,D-cHg}|}d}t|}||krg||}|ddvrtd||dz}d}||kr||}|ddvr|dz}|}|||f||kgt |S)Nr 0123456789zbad feature name: r )splitlen ValueErrorappendtuple)srpartsilengthfeatureversionrs r r"r"RsH GGIIE A ZZF f**( 1: % %*ww@AA A E v::aAt|##E'*+++ f** ??r )Nr)__doc__rrrr rrr"rr r r7s>>  '       )>)>)>)>Vr PKN\s.dom/__pycache__/__init__.cpython-311.opt-1.pycnu[ !A?h~dZGddZdZdZdZdZdZdZd Zd Z d Z d Z d Z dZ dZdZdZdZGddeZGddeZGddeZGddeZGddeZGddeZGdd eZGd!d"eZGd#d$eZGd%d&eZGd'd(eZGd)d*eZGd+d,eZGd-d.eZ Gd/d0eZ!Gd1d2eZ"Gd3d4eZ#Gd5d6Z$d7Z%d8Z&d9Z'd:Z(d:Z)dd;l*m+Z+m,Z,d:S)\ ) )BDD D4-$---"-----r"c|jS)N)code)r/s r# _get_codezDOMException._get_codeHs yr"N)rrrrr.r4rr"r#r)r)>s>II... r"r)ceZdZeZdS) IndexSizeErrN)rrrINDEX_SIZE_ERRr3rr"r#r6r6L DDDr"r6ceZdZeZdS)DomstringSizeErrN)rrrDOMSTRING_SIZE_ERRr3rr"r#r:r:O DDDr"r:ceZdZeZdS)HierarchyRequestErrN)rrrHIERARCHY_REQUEST_ERRr3rr"r#r>r>R DDDr"r>ceZdZeZdS)WrongDocumentErrN)rrrWRONG_DOCUMENT_ERRr3rr"r#rBrBUr<r"rBceZdZeZdS)InvalidCharacterErrN)rrrINVALID_CHARACTER_ERRr3rr"r#rErEXr@r"rEceZdZeZdS)NoDataAllowedErrN)rrrNO_DATA_ALLOWED_ERRr3rr"r#rHrH[ DDDr"rHceZdZeZdS)NoModificationAllowedErrN)rrrNO_MODIFICATION_ALLOWED_ERRr3rr"r#rLrL^s &DDDr"rLceZdZeZdS) NotFoundErrN)rrr NOT_FOUND_ERRr3rr"r#rOrOa DDDr"rOceZdZeZdS)NotSupportedErrN)rrrNOT_SUPPORTED_ERRr3rr"r#rSrSd DDDr"rSceZdZeZdS)InuseAttributeErrN)rrrINUSE_ATTRIBUTE_ERRr3rr"r#rWrWgrJr"rWceZdZeZdS)InvalidStateErrN)rrrINVALID_STATE_ERRr3rr"r#rZrZjrUr"rZceZdZeZdS) SyntaxErrN)rrr SYNTAX_ERRr3rr"r#r]r]ms DDDr"r]ceZdZeZdS)InvalidModificationErrN)rrrINVALID_MODIFICATION_ERRr3rr"r#r`r`ps #DDDr"r`ceZdZeZdS) NamespaceErrN)rrr NAMESPACE_ERRr3rr"r#rcrcsrQr"rcceZdZeZdS)InvalidAccessErrN)rrrINVALID_ACCESS_ERRr3rr"r#rfrfvr<r"rfceZdZeZdS) ValidationErrN)rrrVALIDATION_ERRr3rr"r#ririyr8r"ric"eZdZdZdZdZdZdZdS)UserDataHandlerzBClass giving the operation constants for UserDataHandler.handle().rrrrN)rrrr NODE_CLONED NODE_IMPORTED NODE_DELETED NODE_RENAMEDrr"r#rlrl|s*LLKMLLLLr"rlz$http://www.w3.org/XML/1998/namespacezhttp://www.w3.org/2000/xmlns/zhttp://www.w3.org/1999/xhtmlN)getDOMImplementationregisterDOMImplementation)-rrr7r;r?rCrFrIrMrPrTrXr[r^rardrgrjr-r)r6r:r>rBrErHrLrOrSrWrZr]r`rcrfrirl XML_NAMESPACEXMLNS_NAMESPACEXHTML_NAMESPACEEMPTY_NAMESPACE EMPTY_PREFIXdomregrqrrrr"r#rys"%%%%%%%%4"#!"!"!"!"!"!"!" !"!#!#!# !#!# !#!#     9   <|!!!!!,!!!|!!!!!,!!!|'''''|''',l l $$$$$\$$$<|L7 10 CCCCCCCCCCr"PKN\rW FF*dom/__pycache__/xmlbuilder.cpython-311.pycnu[ !A?hc0dZddlZddlZddlmZgdZGddZGddZd Z Gd d e Z Gd d e Z GddZ [GddZGddZdS)z4Implementation of the DOM Level 3 'LS-Load' feature.N) NodeFilter) DOMBuilderDOMEntityResolverDOMInputSourcec^eZdZdZdZdZdZdZdZdZ dZ dZ dZ dZ dZdZdZdZdZdZdZdZdZdS)OptionszFeatures object that has variables set for each DOMBuilder feature. The DOMBuilder class uses an instance of this class to pass settings to the ExpatBuilder class. TFN)__name__ __module__ __qualname____doc__ namespacesnamespace_declarations validationexternal_parameter_entitiesexternal_general_entitiesexternal_dtd_subsetvalidate_if_schemavalidatedatatype_normalizationcreate_entity_ref_nodesentitieswhitespace_in_element_contentcdata_sectionscommentscharset_overrides_xml_encodinginfosetsupported_mediatypes_only errorHandlerfilter?/opt/alt/python-internal/lib64/python3.11/xml/dom/xmlbuilder.pyrr sJ!J"& $H""H$(!NH%)"G %L FFFr"rc DeZdZdZdZdZdZdZdZdZ eeee fZ dZ dZ dZ d Zd Zd Zd Zd ZdZdZiddgddgddgddgddgddgddgddgddgddgdddgddgddgddgddgddgd d gd!gd"gd#gggd$d%gd&gd'gd(Zd)Zd*Zd+Zd,Zd-ZdS).rNr c,t|_dSN)r_optionsselfs r#__init__zDOMBuilder.__init__9s  r"c|jSr)entityResolverr+s r#_get_entityResolverzDOMBuilder._get_entityResolver<s ""r"c||_dSr)r/)r,r0s r#_set_entityResolverzDOMBuilder._set_entityResolver>s,r"c|jSr)rr+s r#_get_errorHandlerzDOMBuilder._get_errorHandlerAs   r"c||_dSr)r5)r,rs r#_set_errorHandlerzDOMBuilder._set_errorHandlerCs(r"c|jSr)r r+s r# _get_filterzDOMBuilder._get_filterFs {r"c||_dSr)r:)r,r s r# _set_filterzDOMBuilder._set_filterHs  r"cr||rt|rdpd} |jt||f}|D]\}}t|j||dS#t $r$t jd|dwxYwt j dt|z)Nr rzunsupported feature: zunknown feature: ) supportsFeature _settings _name_xformsetattrr*KeyErrorxmldomNotSupportedErr NotFoundErrrepr)r,namestatesettingsvalues r# setFeaturezDOMBuilder.setFeatureKs    % % HKa$1E 8>;t+<+BC C'%%&9DJJ&FGG Gs A.BcFt|jt|Sr))hasattrr*rA)r,rIs r#r?zDOMBuilder.supportsFeatureYst}k$&7&7888r"c>t||rdpdf}||jvS)Nr r)rAr@)r,rIrJkeys r# canSetFeaturezDOMBuilder.canSetFeature\s*4  %+A"23dn$$r"rr)rr )rr)rr)rr )rr)rr rrrr)rr rr)rr )rrrr rr)rr )rrrr rrrr ) rSrTrUrVrX)rr rWrYr[rrrrrr )rYrZr[)rr)rr r\r]r^cdt|} t|j|S#t$r|dkrI|j}|jo8|jo1|jo*|jo#|jp|j p|j p |j p|j cYStjdt!|zwxYw)Nrzfeature %s not known)rAgetattrr*AttributeErrorrrrrrrrrrrDrErGrH)r,rIxnameoptionss r# getFeaturezDOMBuilder.getFeaturesD!! K4=%00 0 K K Ky  -6<#A<#,<$B<")!?";$+$>";$+$C";%,$4";%,$: < ==='%%& =EE   , ,'**,, ,{{}}r"N) r r r r async_rrrrrrr!r"r#rrNs|GG FBBB 777 >>>>>>r"rc(eZdZdZdZdZdZdZdS)DOMImplementationLSr r%c|tjd||jkrt S||jkrtjdt d)NzschemaType not yet supportedz'asynchronous builders are not supportedzunknown value for mode)rDrErFMODE_SYNCHRONOUSrMODE_ASYNCHRONOUSrx)r,mode schemaTypes r#createDOMBuilderz$DOMImplementationLS.createDOMBuilderssw  !')).00 0 4( ( (<<  4) ) )'))9;; ;1222r"c td)Nz-the writer interface hasn't been written yet!rr+s r#createDOMWriterz#DOMImplementationLS.createDOMWriter~s! ;== =r"ctSr))rr+s r#createDOMInputSourcez(DOMImplementationLS.createDOMInputSourcesr"N)r r r r r rrrr!r"r#rrosM 3 3 3===     r"r)r rmxml.domrDxml.dom.NodeFilterr__all__rrrAobjectrrrrrr!r"r#rs:: )))))) @ ? ?@a)a)a)a)a)a)a)a)H***):):):):):):):):X.....V...b""""""""4B          r"PKN\^Nf 0dom/__pycache__/minicompat.cpython-311.opt-2.pycnu[ !A?h' \ gdZddlZefZGddeZGddeZdZ dS))NodeList EmptyNodeList StringTypes defpropertyNcFeZdZdZdZdZdZeeedZdZ dS) rcRd|cxkrt|kr ndS||SdSNrlenselfindexs ?/opt/alt/python-internal/lib64/python3.11/xml/dom/minicompat.pyitemz NodeList.item5s?  ! ! ! !D ! ! ! ! ! !;  " !c t|SNr rs r _get_lengthzNodeList._get_length9s4yyrc@tjdNz.attempt to modify read-only attribute 'length'xmldomNoModificationAllowedErrrvalues r _set_lengthzNodeList._set_length<g.. <>> >r$The number of nodes in the NodeList.docc|g}||dd<dSrr)rstates r __setstate__zNodeList.__setstate__Ds =EQQQrN) __name__ __module__ __qualname__ __slots__rrrpropertylengthr&rrrrr2swI>>>Xk;@BBBFrrcLeZdZdZdZdZdZdZdZe eedZ d S) rrcLt}|||SrrextendrotherNLs r__add__zEmptyNodeList.__add__M" ZZ % rcLt}|||Srr/r1s r__radd__zEmptyNodeList.__radd__Rr5rcdSrrr s rrzEmptyNodeList.itemWstrcdSr rrs rrzEmptyNodeList._get_lengthZsqrc@tjdrrrs rrzEmptyNodeList._set_length]r rr!r"N) r'r(r)r*r4r7rrrr+r,rrrrrJsI  >>>Xk;@BBBFFFrrc|t|d|z}|fd}t|||}t|||dS)N_get_c`tjdt|z)Nz&attempt to modify read-only attribute )rrrrepr)rrnames rsetzdefproperty..setgs-g.. 4tDzz ACC Crr")getattrr+setattr)klassr?r#getr@props rrres^ %'D. * *C"CCCC C# & & &D E4r) __all__xml.domrstrrlistrtuplerrrrrrKsT F E Ef t0BBBBBEBBB6rPKN\Ec0c0dom/xmlbuilder.pynu["""Implementation of the DOM Level 3 'LS-Load' feature.""" import copy import xml.dom from xml.dom.NodeFilter import NodeFilter __all__ = ["DOMBuilder", "DOMEntityResolver", "DOMInputSource"] class Options: """Features object that has variables set for each DOMBuilder feature. The DOMBuilder class uses an instance of this class to pass settings to the ExpatBuilder class. """ # Note that the DOMBuilder class in LoadSave constrains which of these # values can be set using the DOM Level 3 LoadSave feature. namespaces = 1 namespace_declarations = True validation = False external_parameter_entities = True external_general_entities = True external_dtd_subset = True validate_if_schema = False validate = False datatype_normalization = False create_entity_ref_nodes = True entities = True whitespace_in_element_content = True cdata_sections = True comments = True charset_overrides_xml_encoding = True infoset = False supported_mediatypes_only = False errorHandler = None filter = None class DOMBuilder: entityResolver = None errorHandler = None filter = None ACTION_REPLACE = 1 ACTION_APPEND_AS_CHILDREN = 2 ACTION_INSERT_AFTER = 3 ACTION_INSERT_BEFORE = 4 _legal_actions = (ACTION_REPLACE, ACTION_APPEND_AS_CHILDREN, ACTION_INSERT_AFTER, ACTION_INSERT_BEFORE) def __init__(self): self._options = Options() def _get_entityResolver(self): return self.entityResolver def _set_entityResolver(self, entityResolver): self.entityResolver = entityResolver def _get_errorHandler(self): return self.errorHandler def _set_errorHandler(self, errorHandler): self.errorHandler = errorHandler def _get_filter(self): return self.filter def _set_filter(self, filter): self.filter = filter def setFeature(self, name, state): if self.supportsFeature(name): state = state and 1 or 0 try: settings = self._settings[(_name_xform(name), state)] except KeyError: raise xml.dom.NotSupportedErr( "unsupported feature: %r" % (name,)) from None else: for name, value in settings: setattr(self._options, name, value) else: raise xml.dom.NotFoundErr("unknown feature: " + repr(name)) def supportsFeature(self, name): return hasattr(self._options, _name_xform(name)) def canSetFeature(self, name, state): key = (_name_xform(name), state and 1 or 0) return key in self._settings # This dictionary maps from (feature,value) to a list of # (option,value) pairs that should be set on the Options object. # If a (feature,value) setting is not in this dictionary, it is # not supported by the DOMBuilder. # _settings = { ("namespace_declarations", 0): [ ("namespace_declarations", 0)], ("namespace_declarations", 1): [ ("namespace_declarations", 1)], ("validation", 0): [ ("validation", 0)], ("external_general_entities", 0): [ ("external_general_entities", 0)], ("external_general_entities", 1): [ ("external_general_entities", 1)], ("external_parameter_entities", 0): [ ("external_parameter_entities", 0)], ("external_parameter_entities", 1): [ ("external_parameter_entities", 1)], ("validate_if_schema", 0): [ ("validate_if_schema", 0)], ("create_entity_ref_nodes", 0): [ ("create_entity_ref_nodes", 0)], ("create_entity_ref_nodes", 1): [ ("create_entity_ref_nodes", 1)], ("entities", 0): [ ("create_entity_ref_nodes", 0), ("entities", 0)], ("entities", 1): [ ("entities", 1)], ("whitespace_in_element_content", 0): [ ("whitespace_in_element_content", 0)], ("whitespace_in_element_content", 1): [ ("whitespace_in_element_content", 1)], ("cdata_sections", 0): [ ("cdata_sections", 0)], ("cdata_sections", 1): [ ("cdata_sections", 1)], ("comments", 0): [ ("comments", 0)], ("comments", 1): [ ("comments", 1)], ("charset_overrides_xml_encoding", 0): [ ("charset_overrides_xml_encoding", 0)], ("charset_overrides_xml_encoding", 1): [ ("charset_overrides_xml_encoding", 1)], ("infoset", 0): [], ("infoset", 1): [ ("namespace_declarations", 0), ("validate_if_schema", 0), ("create_entity_ref_nodes", 0), ("entities", 0), ("cdata_sections", 0), ("datatype_normalization", 1), ("whitespace_in_element_content", 1), ("comments", 1), ("charset_overrides_xml_encoding", 1)], ("supported_mediatypes_only", 0): [ ("supported_mediatypes_only", 0)], ("namespaces", 0): [ ("namespaces", 0)], ("namespaces", 1): [ ("namespaces", 1)], } def getFeature(self, name): xname = _name_xform(name) try: return getattr(self._options, xname) except AttributeError: if name == "infoset": options = self._options return (options.datatype_normalization and options.whitespace_in_element_content and options.comments and options.charset_overrides_xml_encoding and not (options.namespace_declarations or options.validate_if_schema or options.create_entity_ref_nodes or options.entities or options.cdata_sections)) raise xml.dom.NotFoundErr("feature %s not known" % repr(name)) def parseURI(self, uri): if self.entityResolver: input = self.entityResolver.resolveEntity(None, uri) else: input = DOMEntityResolver().resolveEntity(None, uri) return self.parse(input) def parse(self, input): options = copy.copy(self._options) options.filter = self.filter options.errorHandler = self.errorHandler fp = input.byteStream if fp is None and options.systemId: import urllib.request fp = urllib.request.urlopen(input.systemId) return self._parse_bytestream(fp, options) def parseWithContext(self, input, cnode, action): if action not in self._legal_actions: raise ValueError("not a legal action") raise NotImplementedError("Haven't written this yet...") def _parse_bytestream(self, stream, options): import xml.dom.expatbuilder builder = xml.dom.expatbuilder.makeBuilder(options) return builder.parseFile(stream) def _name_xform(name): return name.lower().replace('-', '_') class DOMEntityResolver(object): __slots__ = '_opener', def resolveEntity(self, publicId, systemId): assert systemId is not None source = DOMInputSource() source.publicId = publicId source.systemId = systemId source.byteStream = self._get_opener().open(systemId) # determine the encoding if the transport provided it source.encoding = self._guess_media_encoding(source) # determine the base URI is we can import posixpath, urllib.parse parts = urllib.parse.urlparse(systemId) scheme, netloc, path, params, query, fragment = parts # XXX should we check the scheme here as well? if path and not path.endswith("/"): path = posixpath.dirname(path) + "/" parts = scheme, netloc, path, params, query, fragment source.baseURI = urllib.parse.urlunparse(parts) return source def _get_opener(self): try: return self._opener except AttributeError: self._opener = self._create_opener() return self._opener def _create_opener(self): import urllib.request return urllib.request.build_opener() def _guess_media_encoding(self, source): info = source.byteStream.info() if "Content-Type" in info: for param in info.getplist(): if param.startswith("charset="): return param.split("=", 1)[1].lower() class DOMInputSource(object): __slots__ = ('byteStream', 'characterStream', 'stringData', 'encoding', 'publicId', 'systemId', 'baseURI') def __init__(self): self.byteStream = None self.characterStream = None self.stringData = None self.encoding = None self.publicId = None self.systemId = None self.baseURI = None def _get_byteStream(self): return self.byteStream def _set_byteStream(self, byteStream): self.byteStream = byteStream def _get_characterStream(self): return self.characterStream def _set_characterStream(self, characterStream): self.characterStream = characterStream def _get_stringData(self): return self.stringData def _set_stringData(self, data): self.stringData = data def _get_encoding(self): return self.encoding def _set_encoding(self, encoding): self.encoding = encoding def _get_publicId(self): return self.publicId def _set_publicId(self, publicId): self.publicId = publicId def _get_systemId(self): return self.systemId def _set_systemId(self, systemId): self.systemId = systemId def _get_baseURI(self): return self.baseURI def _set_baseURI(self, uri): self.baseURI = uri class DOMBuilderFilter: """Element filter which can be used to tailor construction of a DOM instance. """ # There's really no need for this class; concrete implementations # should just implement the endElement() and startElement() # methods as appropriate. Using this makes it easy to only # implement one of them. FILTER_ACCEPT = 1 FILTER_REJECT = 2 FILTER_SKIP = 3 FILTER_INTERRUPT = 4 whatToShow = NodeFilter.SHOW_ALL def _get_whatToShow(self): return self.whatToShow def acceptNode(self, element): return self.FILTER_ACCEPT def startContainer(self, element): return self.FILTER_ACCEPT del NodeFilter class DocumentLS: """Mixin to create documents that conform to the load/save spec.""" async_ = False def _get_async(self): return False def _set_async(self, flag): if flag: raise xml.dom.NotSupportedErr( "asynchronous document loading is not supported") def abort(self): # What does it mean to "clear" a document? Does the # documentElement disappear? raise NotImplementedError( "haven't figured out what this means yet") def load(self, uri): raise NotImplementedError("haven't written this yet") def loadXML(self, source): raise NotImplementedError("haven't written this yet") def saveXML(self, snode): if snode is None: snode = self elif snode.ownerDocument is not self: raise xml.dom.WrongDocumentErr() return snode.toxml() class DOMImplementationLS: MODE_SYNCHRONOUS = 1 MODE_ASYNCHRONOUS = 2 def createDOMBuilder(self, mode, schemaType): if schemaType is not None: raise xml.dom.NotSupportedErr( "schemaType not yet supported") if mode == self.MODE_SYNCHRONOUS: return DOMBuilder() if mode == self.MODE_ASYNCHRONOUS: raise xml.dom.NotSupportedErr( "asynchronous builders are not supported") raise ValueError("unknown value for mode") def createDOMWriter(self): raise NotImplementedError( "the writer interface hasn't been written yet!") def createDOMInputSource(self): return DOMInputSource() PKN\mmtdom/NodeFilter.pynu[# This is the Python mapping for interface NodeFilter from # DOM2-Traversal-Range. It contains only constants. class NodeFilter: """ This is the DOM2 NodeFilter interface. It contains only constants. """ FILTER_ACCEPT = 1 FILTER_REJECT = 2 FILTER_SKIP = 3 SHOW_ALL = 0xFFFFFFFF SHOW_ELEMENT = 0x00000001 SHOW_ATTRIBUTE = 0x00000002 SHOW_TEXT = 0x00000004 SHOW_CDATA_SECTION = 0x00000008 SHOW_ENTITY_REFERENCE = 0x00000010 SHOW_ENTITY = 0x00000020 SHOW_PROCESSING_INSTRUCTION = 0x00000040 SHOW_COMMENT = 0x00000080 SHOW_DOCUMENT = 0x00000100 SHOW_DOCUMENT_TYPE = 0x00000200 SHOW_DOCUMENT_FRAGMENT = 0x00000400 SHOW_NOTATION = 0x00000800 def acceptNode(self, node): raise NotImplementedError PKN\' ' dom/minicompat.pynu["""Python version compatibility support for minidom. This module contains internal implementation details and should not be imported; use xml.dom.minidom instead. """ # This module should only be imported using "import *". # # The following names are defined: # # NodeList -- lightest possible NodeList implementation # # EmptyNodeList -- lightest possible NodeList that is guaranteed to # remain empty (immutable) # # StringTypes -- tuple of defined string types # # defproperty -- function used in conjunction with GetattrMagic; # using these together is needed to make them work # as efficiently as possible in both Python 2.2+ # and older versions. For example: # # class MyClass(GetattrMagic): # def _get_myattr(self): # return something # # defproperty(MyClass, "myattr", # "return some value") # # For Python 2.2 and newer, this will construct a # property object on the class, which avoids # needing to override __getattr__(). It will only # work for read-only attributes. # # For older versions of Python, inheriting from # GetattrMagic will use the traditional # __getattr__() hackery to achieve the same effect, # but less efficiently. # # defproperty() should be used for each version of # the relevant _get_() function. __all__ = ["NodeList", "EmptyNodeList", "StringTypes", "defproperty"] import xml.dom StringTypes = (str,) class NodeList(list): __slots__ = () def item(self, index): if 0 <= index < len(self): return self[index] def _get_length(self): return len(self) def _set_length(self, value): raise xml.dom.NoModificationAllowedErr( "attempt to modify read-only attribute 'length'") length = property(_get_length, _set_length, doc="The number of nodes in the NodeList.") # For backward compatibility def __setstate__(self, state): if state is None: state = [] self[:] = state class EmptyNodeList(tuple): __slots__ = () def __add__(self, other): NL = NodeList() NL.extend(other) return NL def __radd__(self, other): NL = NodeList() NL.extend(other) return NL def item(self, index): return None def _get_length(self): return 0 def _set_length(self, value): raise xml.dom.NoModificationAllowedErr( "attempt to modify read-only attribute 'length'") length = property(_get_length, _set_length, doc="The number of nodes in the NodeList.") def defproperty(klass, name, doc): get = getattr(klass, ("_get_" + name)) def set(self, value, name=name): raise xml.dom.NoModificationAllowedErr( "attempt to modify read-only attribute " + repr(name)) assert not hasattr(klass, "_set_" + name), \ "expected not to find _set_" + name prop = property(get, set, doc=doc) setattr(klass, name, prop) PKN\ȳdom/__init__.pynu["""W3C Document Object Model implementation for Python. The Python mapping of the Document Object Model is documented in the Python Library Reference in the section on the xml.dom package. This package contains the following modules: minidom -- A simple implementation of the Level 1 DOM with namespace support added (based on the Level 2 specification) and other minor Level 2 functionality. pulldom -- DOM builder supporting on-demand tree-building for selected subtrees of the document. """ class Node: """Class giving the NodeType constants.""" __slots__ = () # DOM implementations may use this as a base class for their own # Node implementations. If they don't, the constants defined here # should still be used as the canonical definitions as they match # the values given in the W3C recommendation. Client code can # safely refer to these values in all tests of Node.nodeType # values. ELEMENT_NODE = 1 ATTRIBUTE_NODE = 2 TEXT_NODE = 3 CDATA_SECTION_NODE = 4 ENTITY_REFERENCE_NODE = 5 ENTITY_NODE = 6 PROCESSING_INSTRUCTION_NODE = 7 COMMENT_NODE = 8 DOCUMENT_NODE = 9 DOCUMENT_TYPE_NODE = 10 DOCUMENT_FRAGMENT_NODE = 11 NOTATION_NODE = 12 #ExceptionCode INDEX_SIZE_ERR = 1 DOMSTRING_SIZE_ERR = 2 HIERARCHY_REQUEST_ERR = 3 WRONG_DOCUMENT_ERR = 4 INVALID_CHARACTER_ERR = 5 NO_DATA_ALLOWED_ERR = 6 NO_MODIFICATION_ALLOWED_ERR = 7 NOT_FOUND_ERR = 8 NOT_SUPPORTED_ERR = 9 INUSE_ATTRIBUTE_ERR = 10 INVALID_STATE_ERR = 11 SYNTAX_ERR = 12 INVALID_MODIFICATION_ERR = 13 NAMESPACE_ERR = 14 INVALID_ACCESS_ERR = 15 VALIDATION_ERR = 16 class DOMException(Exception): """Abstract base class for DOM exceptions. Exceptions with specific codes are specializations of this class.""" def __init__(self, *args, **kw): if self.__class__ is DOMException: raise RuntimeError( "DOMException should not be instantiated directly") Exception.__init__(self, *args, **kw) def _get_code(self): return self.code class IndexSizeErr(DOMException): code = INDEX_SIZE_ERR class DomstringSizeErr(DOMException): code = DOMSTRING_SIZE_ERR class HierarchyRequestErr(DOMException): code = HIERARCHY_REQUEST_ERR class WrongDocumentErr(DOMException): code = WRONG_DOCUMENT_ERR class InvalidCharacterErr(DOMException): code = INVALID_CHARACTER_ERR class NoDataAllowedErr(DOMException): code = NO_DATA_ALLOWED_ERR class NoModificationAllowedErr(DOMException): code = NO_MODIFICATION_ALLOWED_ERR class NotFoundErr(DOMException): code = NOT_FOUND_ERR class NotSupportedErr(DOMException): code = NOT_SUPPORTED_ERR class InuseAttributeErr(DOMException): code = INUSE_ATTRIBUTE_ERR class InvalidStateErr(DOMException): code = INVALID_STATE_ERR class SyntaxErr(DOMException): code = SYNTAX_ERR class InvalidModificationErr(DOMException): code = INVALID_MODIFICATION_ERR class NamespaceErr(DOMException): code = NAMESPACE_ERR class InvalidAccessErr(DOMException): code = INVALID_ACCESS_ERR class ValidationErr(DOMException): code = VALIDATION_ERR class UserDataHandler: """Class giving the operation constants for UserDataHandler.handle().""" # Based on DOM Level 3 (WD 9 April 2002) NODE_CLONED = 1 NODE_IMPORTED = 2 NODE_DELETED = 3 NODE_RENAMED = 4 XML_NAMESPACE = "http://www.w3.org/XML/1998/namespace" XMLNS_NAMESPACE = "http://www.w3.org/2000/xmlns/" XHTML_NAMESPACE = "http://www.w3.org/1999/xhtml" EMPTY_NAMESPACE = None EMPTY_PREFIX = None from .domreg import getDOMImplementation, registerDOMImplementation PKN\ 5Iu-u-dom/pulldom.pynu[import xml.sax import xml.sax.handler START_ELEMENT = "START_ELEMENT" END_ELEMENT = "END_ELEMENT" COMMENT = "COMMENT" START_DOCUMENT = "START_DOCUMENT" END_DOCUMENT = "END_DOCUMENT" PROCESSING_INSTRUCTION = "PROCESSING_INSTRUCTION" IGNORABLE_WHITESPACE = "IGNORABLE_WHITESPACE" CHARACTERS = "CHARACTERS" class PullDOM(xml.sax.ContentHandler): _locator = None document = None def __init__(self, documentFactory=None): from xml.dom import XML_NAMESPACE self.documentFactory = documentFactory self.firstEvent = [None, None] self.lastEvent = self.firstEvent self.elementStack = [] self.push = self.elementStack.append try: self.pop = self.elementStack.pop except AttributeError: # use class' pop instead pass self._ns_contexts = [{XML_NAMESPACE:'xml'}] # contains uri -> prefix dicts self._current_context = self._ns_contexts[-1] self.pending_events = [] def pop(self): result = self.elementStack[-1] del self.elementStack[-1] return result def setDocumentLocator(self, locator): self._locator = locator def startPrefixMapping(self, prefix, uri): if not hasattr(self, '_xmlns_attrs'): self._xmlns_attrs = [] self._xmlns_attrs.append((prefix or 'xmlns', uri)) self._ns_contexts.append(self._current_context.copy()) self._current_context[uri] = prefix or None def endPrefixMapping(self, prefix): self._current_context = self._ns_contexts.pop() def startElementNS(self, name, tagName , attrs): # Retrieve xml namespace declaration attributes. xmlns_uri = 'http://www.w3.org/2000/xmlns/' xmlns_attrs = getattr(self, '_xmlns_attrs', None) if xmlns_attrs is not None: for aname, value in xmlns_attrs: attrs._attrs[(xmlns_uri, aname)] = value self._xmlns_attrs = [] uri, localname = name if uri: # When using namespaces, the reader may or may not # provide us with the original name. If not, create # *a* valid tagName from the current context. if tagName is None: prefix = self._current_context[uri] if prefix: tagName = prefix + ":" + localname else: tagName = localname if self.document: node = self.document.createElementNS(uri, tagName) else: node = self.buildDocument(uri, tagName) else: # When the tagname is not prefixed, it just appears as # localname if self.document: node = self.document.createElement(localname) else: node = self.buildDocument(None, localname) for aname,value in attrs.items(): a_uri, a_localname = aname if a_uri == xmlns_uri: if a_localname == 'xmlns': qname = a_localname else: qname = 'xmlns:' + a_localname attr = self.document.createAttributeNS(a_uri, qname) node.setAttributeNodeNS(attr) elif a_uri: prefix = self._current_context[a_uri] if prefix: qname = prefix + ":" + a_localname else: qname = a_localname attr = self.document.createAttributeNS(a_uri, qname) node.setAttributeNodeNS(attr) else: attr = self.document.createAttribute(a_localname) node.setAttributeNode(attr) attr.value = value self.lastEvent[1] = [(START_ELEMENT, node), None] self.lastEvent = self.lastEvent[1] self.push(node) def endElementNS(self, name, tagName): self.lastEvent[1] = [(END_ELEMENT, self.pop()), None] self.lastEvent = self.lastEvent[1] def startElement(self, name, attrs): if self.document: node = self.document.createElement(name) else: node = self.buildDocument(None, name) for aname,value in attrs.items(): attr = self.document.createAttribute(aname) attr.value = value node.setAttributeNode(attr) self.lastEvent[1] = [(START_ELEMENT, node), None] self.lastEvent = self.lastEvent[1] self.push(node) def endElement(self, name): self.lastEvent[1] = [(END_ELEMENT, self.pop()), None] self.lastEvent = self.lastEvent[1] def comment(self, s): if self.document: node = self.document.createComment(s) self.lastEvent[1] = [(COMMENT, node), None] self.lastEvent = self.lastEvent[1] else: event = [(COMMENT, s), None] self.pending_events.append(event) def processingInstruction(self, target, data): if self.document: node = self.document.createProcessingInstruction(target, data) self.lastEvent[1] = [(PROCESSING_INSTRUCTION, node), None] self.lastEvent = self.lastEvent[1] else: event = [(PROCESSING_INSTRUCTION, target, data), None] self.pending_events.append(event) def ignorableWhitespace(self, chars): node = self.document.createTextNode(chars) self.lastEvent[1] = [(IGNORABLE_WHITESPACE, node), None] self.lastEvent = self.lastEvent[1] def characters(self, chars): node = self.document.createTextNode(chars) self.lastEvent[1] = [(CHARACTERS, node), None] self.lastEvent = self.lastEvent[1] def startDocument(self): if self.documentFactory is None: import xml.dom.minidom self.documentFactory = xml.dom.minidom.Document.implementation def buildDocument(self, uri, tagname): # Can't do that in startDocument, since we need the tagname # XXX: obtain DocumentType node = self.documentFactory.createDocument(uri, tagname, None) self.document = node self.lastEvent[1] = [(START_DOCUMENT, node), None] self.lastEvent = self.lastEvent[1] self.push(node) # Put everything we have seen so far into the document for e in self.pending_events: if e[0][0] == PROCESSING_INSTRUCTION: _,target,data = e[0] n = self.document.createProcessingInstruction(target, data) e[0] = (PROCESSING_INSTRUCTION, n) elif e[0][0] == COMMENT: n = self.document.createComment(e[0][1]) e[0] = (COMMENT, n) else: raise AssertionError("Unknown pending event ",e[0][0]) self.lastEvent[1] = e self.lastEvent = e self.pending_events = None return node.firstChild def endDocument(self): self.lastEvent[1] = [(END_DOCUMENT, self.document), None] self.pop() def clear(self): "clear(): Explicitly release parsing structures" self.document = None class ErrorHandler: def warning(self, exception): print(exception) def error(self, exception): raise exception def fatalError(self, exception): raise exception class DOMEventStream: def __init__(self, stream, parser, bufsize): self.stream = stream self.parser = parser self.bufsize = bufsize if not hasattr(self.parser, 'feed'): self.getEvent = self._slurp self.reset() def reset(self): self.pulldom = PullDOM() # This content handler relies on namespace support self.parser.setFeature(xml.sax.handler.feature_namespaces, 1) self.parser.setContentHandler(self.pulldom) def __next__(self): rc = self.getEvent() if rc: return rc raise StopIteration def __iter__(self): return self def expandNode(self, node): event = self.getEvent() parents = [node] while event: token, cur_node = event if cur_node is node: return if token != END_ELEMENT: parents[-1].appendChild(cur_node) if token == START_ELEMENT: parents.append(cur_node) elif token == END_ELEMENT: del parents[-1] event = self.getEvent() def getEvent(self): # use IncrementalParser interface, so we get the desired # pull effect if not self.pulldom.firstEvent[1]: self.pulldom.lastEvent = self.pulldom.firstEvent while not self.pulldom.firstEvent[1]: buf = self.stream.read(self.bufsize) if not buf: self.parser.close() return None self.parser.feed(buf) rc = self.pulldom.firstEvent[1][0] self.pulldom.firstEvent[1] = self.pulldom.firstEvent[1][1] return rc def _slurp(self): """ Fallback replacement for getEvent() using the standard SAX2 interface, which means we slurp the SAX events into memory (no performance gain, but we are compatible to all SAX parsers). """ self.parser.parse(self.stream) self.getEvent = self._emit return self._emit() def _emit(self): """ Fallback replacement for getEvent() that emits the events that _slurp() read previously. """ rc = self.pulldom.firstEvent[1][0] self.pulldom.firstEvent[1] = self.pulldom.firstEvent[1][1] return rc def clear(self): """clear(): Explicitly release parsing objects""" self.pulldom.clear() del self.pulldom self.parser = None self.stream = None class SAX2DOM(PullDOM): def startElementNS(self, name, tagName , attrs): PullDOM.startElementNS(self, name, tagName, attrs) curNode = self.elementStack[-1] parentNode = self.elementStack[-2] parentNode.appendChild(curNode) def startElement(self, name, attrs): PullDOM.startElement(self, name, attrs) curNode = self.elementStack[-1] parentNode = self.elementStack[-2] parentNode.appendChild(curNode) def processingInstruction(self, target, data): PullDOM.processingInstruction(self, target, data) node = self.lastEvent[0][1] parentNode = self.elementStack[-1] parentNode.appendChild(node) def ignorableWhitespace(self, chars): PullDOM.ignorableWhitespace(self, chars) node = self.lastEvent[0][1] parentNode = self.elementStack[-1] parentNode.appendChild(node) def characters(self, chars): PullDOM.characters(self, chars) node = self.lastEvent[0][1] parentNode = self.elementStack[-1] parentNode.appendChild(node) default_bufsize = (2 ** 14) - 20 def parse(stream_or_string, parser=None, bufsize=None): if bufsize is None: bufsize = default_bufsize if isinstance(stream_or_string, str): stream = open(stream_or_string, 'rb') else: stream = stream_or_string if not parser: parser = xml.sax.make_parser() return DOMEventStream(stream, parser, bufsize) def parseString(string, parser=None): from io import StringIO bufsize = len(string) buf = StringIO(string) if not parser: parser = xml.sax.make_parser() return DOMEventStream(buf, parser, bufsize) PKN\xw{ { dom/domreg.pynu["""Registration facilities for DOM. This module should not be used directly. Instead, the functions getDOMImplementation and registerDOMImplementation should be imported from xml.dom.""" # This is a list of well-known implementations. Well-known names # should be published by posting to xml-sig@python.org, and are # subsequently recorded in this file. import sys well_known_implementations = { 'minidom':'xml.dom.minidom', '4DOM': 'xml.dom.DOMImplementation', } # DOM implementations not officially registered should register # themselves with their registered = {} def registerDOMImplementation(name, factory): """registerDOMImplementation(name, factory) Register the factory function with the name. The factory function should return an object which implements the DOMImplementation interface. The factory function can either return the same object, or a new one (e.g. if that implementation supports some customization).""" registered[name] = factory def _good_enough(dom, features): "_good_enough(dom, features) -> Return 1 if the dom offers the features" for f,v in features: if not dom.hasFeature(f,v): return 0 return 1 def getDOMImplementation(name=None, features=()): """getDOMImplementation(name = None, features = ()) -> DOM implementation. Return a suitable DOM implementation. The name is either well-known, the module name of a DOM implementation, or None. If it is not None, imports the corresponding module and returns DOMImplementation object if the import succeeds. If name is not given, consider the available implementations to find one with the required feature set. If no implementation can be found, raise an ImportError. The features list must be a sequence of (feature, version) pairs which are passed to hasFeature.""" import os creator = None mod = well_known_implementations.get(name) if mod: mod = __import__(mod, {}, {}, ['getDOMImplementation']) return mod.getDOMImplementation() elif name: return registered[name]() elif not sys.flags.ignore_environment and "PYTHON_DOM" in os.environ: return getDOMImplementation(name = os.environ["PYTHON_DOM"]) # User did not specify a name, try implementations in arbitrary # order, returning the one that has the required features if isinstance(features, str): features = _parse_feature_string(features) for creator in registered.values(): dom = creator() if _good_enough(dom, features): return dom for creator in well_known_implementations.keys(): try: dom = getDOMImplementation(name = creator) except Exception: # typically ImportError, or AttributeError continue if _good_enough(dom, features): return dom raise ImportError("no suitable DOM implementation found") def _parse_feature_string(s): features = [] parts = s.split() i = 0 length = len(parts) while i < length: feature = parts[i] if feature[0] in "0123456789": raise ValueError("bad feature name: %r" % (feature,)) i = i + 1 version = None if i < length: v = parts[i] if v[0] in "0123456789": i = i + 1 version = v features.append((feature, version)) return tuple(features) PKN\ő*__pycache__/__init__.cpython-311.opt-2.pycnu[ !A?h- gdZdS))domparserssaxetreeN)__all__9/opt/alt/python-internal/lib64/python3.11/xml/__init__.pyr s& - , ,rPKN\׼$__pycache__/__init__.cpython-311.pycnu[ !A?h-dZgdZdS)aCore XML support for Python. This package contains four sub-packages: dom -- The W3C Document Object Model. This supports DOM Level 1 + Namespaces. parsers -- Python wrappers for XML parsers (currently only supports Expat). sax -- The Simple API for XML, developed by XML-Dev, led by David Megginson and ported to Python by Lars Marius Garshol. This supports the SAX 2 API. etree -- The ElementTree XML library. This is a subset of the full ElementTree XML release. )domparserssaxetreeN)__doc____all__9/opt/alt/python-internal/lib64/python3.11/xml/__init__.pyr s & - , ,r PKN\׼*__pycache__/__init__.cpython-311.opt-1.pycnu[ !A?h-dZgdZdS)aCore XML support for Python. This package contains four sub-packages: dom -- The W3C Document Object Model. This supports DOM Level 1 + Namespaces. parsers -- Python wrappers for XML parsers (currently only supports Expat). sax -- The Simple API for XML, developed by XML-Dev, led by David Megginson and ported to Python by Lars Marius Garshol. This supports the SAX 2 API. etree -- The ElementTree XML library. This is a subset of the full ElementTree XML release. )domparserssaxetreeN)__doc____all__9/opt/alt/python-internal/lib64/python3.11/xml/__init__.pyr s & - , ,r PKN\1`*k)parsers/__pycache__/expat.cpython-311.pycnu[ !A?hBdZddlZddlTeejd<eejd<dS)z1Interface to the Expat non-validating XML parser.N)*zxml.parsers.expat.modelzxml.parsers.expat.errors)__doc__syspyexpatmodelmoduleserrors>/opt/alt/python-internal/lib64/python3.11/xml/parsers/expat.pyr sB77 */ %&*0 &'''r PKN\0ڗ2parsers/__pycache__/__init__.cpython-311.opt-2.pycnu[ !A?hdS)NrA/opt/alt/python-internal/lib64/python3.11/xml/parsers/__init__.pyrsrPKN\1`*k/parsers/__pycache__/expat.cpython-311.opt-1.pycnu[ !A?hBdZddlZddlTeejd<eejd<dS)z1Interface to the Expat non-validating XML parser.N)*zxml.parsers.expat.modelzxml.parsers.expat.errors)__doc__syspyexpatmodelmoduleserrors>/opt/alt/python-internal/lib64/python3.11/xml/parsers/expat.pyr sB77 */ %&*0 &'''r PKN\:xuu/parsers/__pycache__/expat.cpython-311.opt-2.pycnu[ !A?h@ ddlZddlTeejd<eejd<dS)N)*zxml.parsers.expat.modelzxml.parsers.expat.errors)syspyexpatmodelmoduleserrors>/opt/alt/python-internal/lib64/python3.11/xml/parsers/expat.pyr s?7 */ %&*0 &'''r PKN\V Tdd,parsers/__pycache__/__init__.cpython-311.pycnu[ !A?h dZdS)zPython interfaces to XML parsers. This package contains one module: expat -- Python wrapper for James Clark's Expat parser, with namespace support. N)__doc__A/opt/alt/python-internal/lib64/python3.11/xml/parsers/__init__.pyrsrPKN\V Tdd2parsers/__pycache__/__init__.cpython-311.opt-1.pycnu[ !A?h dZdS)zPython interfaces to XML parsers. This package contains one module: expat -- Python wrapper for James Clark's Expat parser, with namespace support. N)__doc__A/opt/alt/python-internal/lib64/python3.11/xml/parsers/__init__.pyrsrPKN\;|parsers/__init__.pynu["""Python interfaces to XML parsers. This package contains one module: expat -- Python wrapper for James Clark's Expat parser, with namespace support. """ PKN\;c}parsers/expat.pynu["""Interface to the Expat non-validating XML parser.""" import sys from pyexpat import * # provide pyexpat submodules as xml.parsers.expat submodules sys.modules['xml.parsers.expat.model'] = model sys.modules['xml.parsers.expat.errors'] = errors PKN\@ X-- __init__.pynu["""Core XML support for Python. This package contains four sub-packages: dom -- The W3C Document Object Model. This supports DOM Level 1 + Namespaces. parsers -- Python wrappers for XML parsers (currently only supports Expat). sax -- The Simple API for XML, developed by XML-Dev, led by David Megginson and ported to Python by Lars Marius Garshol. This supports the SAX 2 API. etree -- The ElementTree XML library. This is a subset of the full ElementTree XML release. """ __all__ = ["dom", "parsers", "sax", "etree"] PKN\Dui4((feed-icon-12x12-orange.pngnuPNG  IHDR Vu\gAMA7tEXtSoftwareAdobe ImageReadyqe<IDATxLKQa#.D! 0$] YҤ66V"@JQP[6j%`%$aw}oT~\}oW~W* A17_ i2 9:^`L.= :ks.MČLiQ*DQTGD@܀Q~q/N[Ylq bz/mN#͂CN}xi4!:Ca[yׯ|<5`iM"[M 9WЮ̓w< Ƀ/0KW>C(|4lM2LUיU:ځujD9:~w^J~.KβW'cՄ#T(E@+/0/{6d&& 0%Q"IENDB`PKN\feed-icon-16x16-orange.pngnuPNG  IHDRagAMA7tEXtSoftwareAdobe ImageReadyqe<IDATxtMHTQs;:CDi\QPDH"sljDQ`ȍ-[&[A.EdXZQOBUgwν3҅yac璉dp0z1,`  SD[[7 MgIFd]'2yEH2֓3+ҢSaHm .Ȃ !0oe/\gD8by,Z  l$(/}iX/c?`[56JbߑSh%vK+ <60:wДj6i zv< A7SuǵXrnނg); du o%}&%Qam'29U ⮦(kbe"Ep;of@zMBmX%GO#,ZjWBV<{GHsm,Ec+Q Xag%߼^c;37q".? zIDbcQN}yCfB|f6yeｆ}uYҨ† [%b5q=`6U6uuh%WA͢i0M;`Q5S:9IENDB`PKKO\tTX||LicenseElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class LicenseElement extends ManifestElement { public function getType(): string { return $this->getAttributeValue('type'); } public function getUrl(): string { return $this->getAttributeValue('url'); } } PKKO\aΉContainsElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class ContainsElement extends ManifestElement { public function getName(): string { return $this->getAttributeValue('name'); } public function getVersion(): string { return $this->getAttributeValue('version'); } public function getType(): string { return $this->getAttributeValue('type'); } public function getExtensionElement(): ExtensionElement { return new ExtensionElement( $this->getChildByName('extension') ); } } PKKO\砲LElementCollection.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; use DOMElement; use DOMNodeList; use Iterator; use ReturnTypeWillChange; use function count; use function get_class; use function sprintf; /** @template-implements Iterator */ abstract class ElementCollection implements Iterator { /** @var DOMElement[] */ private $nodes = []; /** @var int */ private $position; public function __construct(DOMNodeList $nodeList) { $this->position = 0; $this->importNodes($nodeList); } #[ReturnTypeWillChange] abstract public function current(); public function next(): void { $this->position++; } public function key(): int { return $this->position; } public function valid(): bool { return $this->position < count($this->nodes); } public function rewind(): void { $this->position = 0; } protected function getCurrentElement(): DOMElement { return $this->nodes[$this->position]; } private function importNodes(DOMNodeList $nodeList): void { foreach ($nodeList as $node) { if (!$node instanceof DOMElement) { throw new ElementCollectionException( sprintf('\DOMElement expected, got \%s', get_class($node)) ); } $this->nodes[] = $node; } } } PKKO\zjExtensionElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class ExtensionElement extends ManifestElement { public function getFor(): string { return $this->getAttributeValue('for'); } public function getCompatible(): string { return $this->getAttributeValue('compatible'); } } PKKO\ExtElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class ExtElement extends ManifestElement { public function getName(): string { return $this->getAttributeValue('name'); } } PKKO\(7SSAuthorElementCollection.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class AuthorElementCollection extends ElementCollection { public function current(): AuthorElement { return new AuthorElement( $this->getCurrentElement() ); } } PKKO\9S ManifestDocument.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; use DOMDocument; use DOMElement; use Throwable; use function count; use function file_get_contents; use function is_file; use function libxml_clear_errors; use function libxml_get_errors; use function libxml_use_internal_errors; use function sprintf; class ManifestDocument { public const XMLNS = 'https://phar.io/xml/manifest/1.0'; /** @var DOMDocument */ private $dom; public static function fromFile(string $filename): ManifestDocument { if (!is_file($filename)) { throw new ManifestDocumentException( sprintf('File "%s" not found', $filename) ); } return self::fromString( file_get_contents($filename) ); } public static function fromString(string $xmlString): ManifestDocument { $prev = libxml_use_internal_errors(true); libxml_clear_errors(); try { $dom = new DOMDocument(); $dom->loadXML($xmlString); $errors = libxml_get_errors(); libxml_use_internal_errors($prev); } catch (Throwable $t) { throw new ManifestDocumentException($t->getMessage(), 0, $t); } if (count($errors) !== 0) { throw new ManifestDocumentLoadingException($errors); } return new self($dom); } private function __construct(DOMDocument $dom) { $this->ensureCorrectDocumentType($dom); $this->dom = $dom; } public function getContainsElement(): ContainsElement { return new ContainsElement( $this->fetchElementByName('contains') ); } public function getCopyrightElement(): CopyrightElement { return new CopyrightElement( $this->fetchElementByName('copyright') ); } public function getRequiresElement(): RequiresElement { return new RequiresElement( $this->fetchElementByName('requires') ); } public function hasBundlesElement(): bool { return $this->dom->getElementsByTagNameNS(self::XMLNS, 'bundles')->length === 1; } public function getBundlesElement(): BundlesElement { return new BundlesElement( $this->fetchElementByName('bundles') ); } private function ensureCorrectDocumentType(DOMDocument $dom): void { $root = $dom->documentElement; if ($root->localName !== 'phar' || $root->namespaceURI !== self::XMLNS) { throw new ManifestDocumentException('Not a phar.io manifest document'); } } private function fetchElementByName(string $elementName): DOMElement { $element = $this->dom->getElementsByTagNameNS(self::XMLNS, $elementName)->item(0); if (!$element instanceof DOMElement) { throw new ManifestDocumentException( sprintf('Element %s missing', $elementName) ); } return $element; } } PKKO\ܗKKRequiresElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class RequiresElement extends ManifestElement { public function getPHPElement(): PhpElement { return new PhpElement( $this->getChildByName('php') ); } } PKKO\wOPhpElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class PhpElement extends ManifestElement { public function getVersion(): string { return $this->getAttributeValue('version'); } public function hasExtElements(): bool { return $this->hasChild('ext'); } public function getExtElements(): ExtElementCollection { return new ExtElementCollection( $this->getChildrenByName('ext') ); } } PKKO\$SgComponentElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class ComponentElement extends ManifestElement { public function getName(): string { return $this->getAttributeValue('name'); } public function getVersion(): string { return $this->getAttributeValue('version'); } } PKKO\}zzBundlesElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class BundlesElement extends ManifestElement { public function getComponentElements(): ComponentElementCollection { return new ComponentElementCollection( $this->getChildrenByName('component') ); } } PKKO\JJExtElementCollection.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class ExtElementCollection extends ElementCollection { public function current(): ExtElement { return new ExtElement( $this->getCurrentElement() ); } } PKKO\2AuthorElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class AuthorElement extends ManifestElement { public function getName(): string { return $this->getAttributeValue('name'); } public function getEmail(): string { return $this->getAttributeValue('email'); } public function hasEMail(): bool { return $this->hasAttribute('email'); } } PKKO\6 \\ComponentElementCollection.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class ComponentElementCollection extends ElementCollection { public function current(): ComponentElement { return new ComponentElement( $this->getCurrentElement() ); } } PKKO\t)T  CopyrightElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; class CopyrightElement extends ManifestElement { public function getAuthorElements(): AuthorElementCollection { return new AuthorElementCollection( $this->getChildrenByName('author') ); } public function getLicenseElement(): LicenseElement { return new LicenseElement( $this->getChildByName('license') ); } } PKKO\pnnManifestElement.phpnu[, Sebastian Heuer , Sebastian Bergmann and contributors * * For the full copyright and license information, please view the LICENSE * file that was distributed with this source code. * */ namespace PharIo\Manifest; use DOMElement; use DOMNodeList; use function sprintf; class ManifestElement { public const XMLNS = 'https://phar.io/xml/manifest/1.0'; /** @var DOMElement */ private $element; public function __construct(DOMElement $element) { $this->element = $element; } protected function getAttributeValue(string $name): string { if (!$this->element->hasAttribute($name)) { throw new ManifestElementException( sprintf( 'Attribute %s not set on element %s', $name, $this->element->localName ) ); } return $this->element->getAttribute($name); } protected function hasAttribute(string $name): bool { return $this->element->hasAttribute($name); } protected function getChildByName(string $elementName): DOMElement { $element = $this->element->getElementsByTagNameNS(self::XMLNS, $elementName)->item(0); if (!$element instanceof DOMElement) { throw new ManifestElementException( sprintf('Element %s missing', $elementName) ); } return $element; } protected function getChildrenByName(string $elementName): DOMNodeList { $elementList = $this->element->getElementsByTagNameNS(self::XMLNS, $elementName); if ($elementList->length === 0) { throw new ManifestElementException( sprintf('Element(s) %s missing', $elementName) ); } return $elementList; } protected function hasChild(string $elementName): bool { return $this->element->getElementsByTagNameNS(self::XMLNS, $elementName)->length !== 0; } } PKKO\ php_xml.hnu[/* +----------------------------------------------------------------------+ | PHP Version 7 | +----------------------------------------------------------------------+ | Copyright (c) 1997-2018 The PHP Group | +----------------------------------------------------------------------+ | This source file is subject to version 3.01 of the PHP license, | | that is bundled with this package in the file LICENSE, and is | | available through the world-wide-web at the following url: | | http://www.php.net/license/3_01.txt | | If you did not receive a copy of the PHP license and are unable to | | obtain it through the world-wide-web, please send a note to | | license@php.net so we can mail you a copy immediately. | +----------------------------------------------------------------------+ | Authors: Stig Sæther Bakken | | Thies C. Arntzen | | Sterling Hughes | +----------------------------------------------------------------------+ */ /* $Id$ */ #ifndef PHP_XML_H #define PHP_XML_H #ifdef HAVE_XML extern zend_module_entry xml_module_entry; #define xml_module_ptr &xml_module_entry #include "php_version.h" #define PHP_XML_VERSION PHP_VERSION #else #define xml_module_ptr NULL #endif #ifdef HAVE_XML #include "expat_compat.h" #ifdef XML_UNICODE #error "UTF-16 Unicode support not implemented!" #endif ZEND_BEGIN_MODULE_GLOBALS(xml) XML_Char *default_encoding; ZEND_END_MODULE_GLOBALS(xml) typedef struct { int case_folding; XML_Parser parser; XML_Char *target_encoding; zval index; zval startElementHandler; zval endElementHandler; zval characterDataHandler; zval processingInstructionHandler; zval defaultHandler; zval unparsedEntityDeclHandler; zval notationDeclHandler; zval externalEntityRefHandler; zval unknownEncodingHandler; zval startNamespaceDeclHandler; zval endNamespaceDeclHandler; zend_function *startElementPtr; zend_function *endElementPtr; zend_function *characterDataPtr; zend_function *processingInstructionPtr; zend_function *defaultPtr; zend_function *unparsedEntityDeclPtr; zend_function *notationDeclPtr; zend_function *externalEntityRefPtr; zend_function *unknownEncodingPtr; zend_function *startNamespaceDeclPtr; zend_function *endNamespaceDeclPtr; zval object; zval data; zval info; int level; int toffset; int curtag; zval *ctag; char **ltags; int lastwasopen; int skipwhite; int isparsing; XML_Char *baseURI; } xml_parser; typedef struct { XML_Char *name; char (*decoding_function)(unsigned short); unsigned short (*encoding_function)(unsigned char); } xml_encoding; enum php_xml_option { PHP_XML_OPTION_CASE_FOLDING = 1, PHP_XML_OPTION_TARGET_ENCODING, PHP_XML_OPTION_SKIP_TAGSTART, PHP_XML_OPTION_SKIP_WHITE }; /* for xml_parse_into_struct */ #define XML_MAXLEVEL 255 /* XXX this should be dynamic */ PHP_FUNCTION(xml_parser_create); PHP_FUNCTION(xml_parser_create_ns); PHP_FUNCTION(xml_set_object); PHP_FUNCTION(xml_set_element_handler); PHP_FUNCTION(xml_set_character_data_handler); PHP_FUNCTION(xml_set_processing_instruction_handler); PHP_FUNCTION(xml_set_default_handler); PHP_FUNCTION(xml_set_unparsed_entity_decl_handler); PHP_FUNCTION(xml_set_notation_decl_handler); PHP_FUNCTION(xml_set_external_entity_ref_handler); PHP_FUNCTION(xml_set_start_namespace_decl_handler); PHP_FUNCTION(xml_set_end_namespace_decl_handler); PHP_FUNCTION(xml_parse); PHP_FUNCTION(xml_get_error_code); PHP_FUNCTION(xml_error_string); PHP_FUNCTION(xml_get_current_line_number); PHP_FUNCTION(xml_get_current_column_number); PHP_FUNCTION(xml_get_current_byte_index); PHP_FUNCTION(xml_parser_free); PHP_FUNCTION(xml_parser_set_option); PHP_FUNCTION(xml_parser_get_option); PHP_FUNCTION(utf8_encode); PHP_FUNCTION(utf8_decode); PHP_FUNCTION(xml_parse_into_struct); PHP_XML_API char *_xml_zval_strdup(zval *); PHP_XML_API zend_string *xml_utf8_decode(const XML_Char *, size_t, const XML_Char *); PHP_XML_API zend_string *xml_utf8_encode(const char *, size_t, const XML_Char *); #endif /* HAVE_LIBEXPAT */ #define phpext_xml_ptr xml_module_ptr #define XML(v) ZEND_MODULE_GLOBALS_ACCESSOR(xml, v) #if defined(ZTS) && defined(COMPILE_DL_XML) ZEND_TSRMLS_CACHE_EXTERN() #endif #endif /* PHP_XML_H */ /* * Local variables: * tab-width: 4 * c-basic-offset: 4 * End: */ PKKO\J9## xml_arginfo.hnu[/* This is a generated file, edit the .stub.php file instead. * Stub hash: f87e295b35cd43db72a936ee5745297a45730090 */ ZEND_BEGIN_ARG_WITH_RETURN_OBJ_INFO_EX(arginfo_xml_parser_create, 0, 0, XMLParser, 0) ZEND_ARG_TYPE_INFO_WITH_DEFAULT_VALUE(0, encoding, IS_STRING, 1, "null") ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_OBJ_INFO_EX(arginfo_xml_parser_create_ns, 0, 0, XMLParser, 0) ZEND_ARG_TYPE_INFO_WITH_DEFAULT_VALUE(0, encoding, IS_STRING, 1, "null") ZEND_ARG_TYPE_INFO_WITH_DEFAULT_VALUE(0, separator, IS_STRING, 0, "\":\"") ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_set_object, 0, 2, IS_TRUE, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_TYPE_INFO(0, object, IS_OBJECT, 0) ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_set_element_handler, 0, 3, IS_TRUE, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_INFO(0, start_handler) ZEND_ARG_INFO(0, end_handler) ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_set_character_data_handler, 0, 2, IS_TRUE, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_INFO(0, handler) ZEND_END_ARG_INFO() #define arginfo_xml_set_processing_instruction_handler arginfo_xml_set_character_data_handler #define arginfo_xml_set_default_handler arginfo_xml_set_character_data_handler #define arginfo_xml_set_unparsed_entity_decl_handler arginfo_xml_set_character_data_handler #define arginfo_xml_set_notation_decl_handler arginfo_xml_set_character_data_handler #define arginfo_xml_set_external_entity_ref_handler arginfo_xml_set_character_data_handler #define arginfo_xml_set_start_namespace_decl_handler arginfo_xml_set_character_data_handler #define arginfo_xml_set_end_namespace_decl_handler arginfo_xml_set_character_data_handler ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_parse, 0, 2, IS_LONG, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_TYPE_INFO(0, data, IS_STRING, 0) ZEND_ARG_TYPE_INFO_WITH_DEFAULT_VALUE(0, is_final, _IS_BOOL, 0, "false") ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_MASK_EX(arginfo_xml_parse_into_struct, 0, 3, MAY_BE_LONG|MAY_BE_FALSE) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_TYPE_INFO(0, data, IS_STRING, 0) ZEND_ARG_INFO(1, values) ZEND_ARG_INFO_WITH_DEFAULT_VALUE(1, index, "null") ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_get_error_code, 0, 1, IS_LONG, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_error_string, 0, 1, IS_STRING, 1) ZEND_ARG_TYPE_INFO(0, error_code, IS_LONG, 0) ZEND_END_ARG_INFO() #define arginfo_xml_get_current_line_number arginfo_xml_get_error_code #define arginfo_xml_get_current_column_number arginfo_xml_get_error_code #define arginfo_xml_get_current_byte_index arginfo_xml_get_error_code ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_parser_free, 0, 1, _IS_BOOL, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_INFO_EX(arginfo_xml_parser_set_option, 0, 3, _IS_BOOL, 0) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_TYPE_INFO(0, option, IS_LONG, 0) ZEND_ARG_INFO(0, value) ZEND_END_ARG_INFO() ZEND_BEGIN_ARG_WITH_RETURN_TYPE_MASK_EX(arginfo_xml_parser_get_option, 0, 2, MAY_BE_STRING|MAY_BE_LONG|MAY_BE_BOOL) ZEND_ARG_OBJ_INFO(0, parser, XMLParser, 0) ZEND_ARG_TYPE_INFO(0, option, IS_LONG, 0) ZEND_END_ARG_INFO() ZEND_FUNCTION(xml_parser_create); ZEND_FUNCTION(xml_parser_create_ns); ZEND_FUNCTION(xml_set_object); ZEND_FUNCTION(xml_set_element_handler); ZEND_FUNCTION(xml_set_character_data_handler); ZEND_FUNCTION(xml_set_processing_instruction_handler); ZEND_FUNCTION(xml_set_default_handler); ZEND_FUNCTION(xml_set_unparsed_entity_decl_handler); ZEND_FUNCTION(xml_set_notation_decl_handler); ZEND_FUNCTION(xml_set_external_entity_ref_handler); ZEND_FUNCTION(xml_set_start_namespace_decl_handler); ZEND_FUNCTION(xml_set_end_namespace_decl_handler); ZEND_FUNCTION(xml_parse); ZEND_FUNCTION(xml_parse_into_struct); ZEND_FUNCTION(xml_get_error_code); ZEND_FUNCTION(xml_error_string); ZEND_FUNCTION(xml_get_current_line_number); ZEND_FUNCTION(xml_get_current_column_number); ZEND_FUNCTION(xml_get_current_byte_index); ZEND_FUNCTION(xml_parser_free); ZEND_FUNCTION(xml_parser_set_option); ZEND_FUNCTION(xml_parser_get_option); static const zend_function_entry ext_functions[] = { ZEND_FE(xml_parser_create, arginfo_xml_parser_create) ZEND_FE(xml_parser_create_ns, arginfo_xml_parser_create_ns) ZEND_FE(xml_set_object, arginfo_xml_set_object) ZEND_FE(xml_set_element_handler, arginfo_xml_set_element_handler) ZEND_FE(xml_set_character_data_handler, arginfo_xml_set_character_data_handler) ZEND_FE(xml_set_processing_instruction_handler, arginfo_xml_set_processing_instruction_handler) ZEND_FE(xml_set_default_handler, arginfo_xml_set_default_handler) ZEND_FE(xml_set_unparsed_entity_decl_handler, arginfo_xml_set_unparsed_entity_decl_handler) ZEND_FE(xml_set_notation_decl_handler, arginfo_xml_set_notation_decl_handler) ZEND_FE(xml_set_external_entity_ref_handler, arginfo_xml_set_external_entity_ref_handler) ZEND_FE(xml_set_start_namespace_decl_handler, arginfo_xml_set_start_namespace_decl_handler) ZEND_FE(xml_set_end_namespace_decl_handler, arginfo_xml_set_end_namespace_decl_handler) ZEND_FE(xml_parse, arginfo_xml_parse) ZEND_FE(xml_parse_into_struct, arginfo_xml_parse_into_struct) ZEND_FE(xml_get_error_code, arginfo_xml_get_error_code) ZEND_FE(xml_error_string, arginfo_xml_error_string) ZEND_FE(xml_get_current_line_number, arginfo_xml_get_current_line_number) ZEND_FE(xml_get_current_column_number, arginfo_xml_get_current_column_number) ZEND_FE(xml_get_current_byte_index, arginfo_xml_get_current_byte_index) ZEND_FE(xml_parser_free, arginfo_xml_parser_free) ZEND_FE(xml_parser_set_option, arginfo_xml_parser_set_option) ZEND_FE(xml_parser_get_option, arginfo_xml_parser_get_option) ZEND_FE_END }; static const zend_function_entry class_XMLParser_methods[] = { ZEND_FE_END }; static void register_xml_symbols(int module_number) { REGISTER_LONG_CONSTANT("XML_ERROR_NONE", XML_ERROR_NONE, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_NO_MEMORY", XML_ERROR_NO_MEMORY, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_SYNTAX", XML_ERROR_SYNTAX, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_NO_ELEMENTS", XML_ERROR_NO_ELEMENTS, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_INVALID_TOKEN", XML_ERROR_INVALID_TOKEN, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_UNCLOSED_TOKEN", XML_ERROR_UNCLOSED_TOKEN, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_PARTIAL_CHAR", XML_ERROR_PARTIAL_CHAR, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_TAG_MISMATCH", XML_ERROR_TAG_MISMATCH, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_DUPLICATE_ATTRIBUTE", XML_ERROR_DUPLICATE_ATTRIBUTE, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_JUNK_AFTER_DOC_ELEMENT", XML_ERROR_JUNK_AFTER_DOC_ELEMENT, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_PARAM_ENTITY_REF", XML_ERROR_PARAM_ENTITY_REF, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_UNDEFINED_ENTITY", XML_ERROR_UNDEFINED_ENTITY, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_RECURSIVE_ENTITY_REF", XML_ERROR_RECURSIVE_ENTITY_REF, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_ASYNC_ENTITY", XML_ERROR_ASYNC_ENTITY, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_BAD_CHAR_REF", XML_ERROR_BAD_CHAR_REF, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_BINARY_ENTITY_REF", XML_ERROR_BINARY_ENTITY_REF, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_ATTRIBUTE_EXTERNAL_ENTITY_REF", XML_ERROR_ATTRIBUTE_EXTERNAL_ENTITY_REF, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_MISPLACED_XML_PI", XML_ERROR_MISPLACED_XML_PI, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_UNKNOWN_ENCODING", XML_ERROR_UNKNOWN_ENCODING, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_INCORRECT_ENCODING", XML_ERROR_INCORRECT_ENCODING, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_UNCLOSED_CDATA_SECTION", XML_ERROR_UNCLOSED_CDATA_SECTION, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_ERROR_EXTERNAL_ENTITY_HANDLING", XML_ERROR_EXTERNAL_ENTITY_HANDLING, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_OPTION_CASE_FOLDING", PHP_XML_OPTION_CASE_FOLDING, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_OPTION_TARGET_ENCODING", PHP_XML_OPTION_TARGET_ENCODING, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_OPTION_SKIP_TAGSTART", PHP_XML_OPTION_SKIP_TAGSTART, CONST_PERSISTENT); REGISTER_LONG_CONSTANT("XML_OPTION_SKIP_WHITE", PHP_XML_OPTION_SKIP_WHITE, CONST_PERSISTENT); REGISTER_STRING_CONSTANT("XML_SAX_IMPL", PHP_XML_SAX_IMPL, CONST_PERSISTENT); } static zend_class_entry *register_class_XMLParser(void) { zend_class_entry ce, *class_entry; INIT_CLASS_ENTRY(ce, "XMLParser", class_XMLParser_methods); class_entry = zend_register_internal_class_ex(&ce, NULL); class_entry->ce_flags |= ZEND_ACC_FINAL|ZEND_ACC_NO_DYNAMIC_PROPERTIES|ZEND_ACC_NOT_SERIALIZABLE; return class_entry; } PKKO\B(hnnexpat_compat.hnu[/* +----------------------------------------------------------------------+ | PHP Version 7 | +----------------------------------------------------------------------+ | Copyright (c) 1997-2018 The PHP Group | +----------------------------------------------------------------------+ | This source file is subject to version 3.01 of the PHP license, | | that is bundled with this package in the file LICENSE, and is | | available through the world-wide-web at the following url: | | http://www.php.net/license/3_01.txt | | If you did not receive a copy of the PHP license and are unable to | | obtain it through the world-wide-web, please send a note to | | license@php.net so we can mail you a copy immediately. | +----------------------------------------------------------------------+ | Authors: Sterling Hughes | +----------------------------------------------------------------------+ */ /* $Id$ */ #ifndef PHP_EXPAT_COMPAT_H #define PHP_EXPAT_COMPAT_H #ifdef PHP_WIN32 #include "config.w32.h" #else #include #endif #ifdef PHP_WIN32 # define PHP_XML_API __declspec(dllexport) #elif defined(__GNUC__) && __GNUC__ >= 4 # define PHP_XML_API __attribute__ ((visibility("default"))) #else # define PHP_XML_API #endif #if !defined(HAVE_LIBEXPAT) && defined(HAVE_LIBXML) #define LIBXML_EXPAT_COMPAT 1 #include "php.h" #include "php_compat.h" #include #include #include #include /* For compatibility with the misspelled version. */ #define _ns_seperator _ns_separator typedef xmlChar XML_Char; typedef void (*XML_StartElementHandler)(void *, const XML_Char *, const XML_Char **); typedef void (*XML_EndElementHandler)(void *, const XML_Char *); typedef void (*XML_CharacterDataHandler)(void *, const XML_Char *, int); typedef void (*XML_ProcessingInstructionHandler)(void *, const XML_Char *, const XML_Char *); typedef void (*XML_CommentHandler)(void *, const XML_Char *); typedef void (*XML_DefaultHandler)(void *, const XML_Char *, int); typedef void (*XML_UnparsedEntityDeclHandler)(void *, const XML_Char *, const XML_Char *, const XML_Char *, const XML_Char *, const XML_Char *); typedef void (*XML_NotationDeclHandler)(void *, const XML_Char *, const XML_Char *, const XML_Char *, const XML_Char *); typedef int (*XML_ExternalEntityRefHandler)(void *, const XML_Char *, const XML_Char *, const XML_Char *, const XML_Char *); typedef void (*XML_StartNamespaceDeclHandler)(void *, const XML_Char *, const XML_Char *); typedef void (*XML_EndNamespaceDeclHandler)(void *, const XML_Char *); typedef struct _XML_Memory_Handling_Suite { void *(*malloc_fcn)(size_t size); void *(*realloc_fcn)(void *ptr, size_t size); void (*free_fcn)(void *ptr); } XML_Memory_Handling_Suite; typedef struct _XML_Parser { int use_namespace; xmlChar *_ns_separator; void *user; xmlParserCtxtPtr parser; XML_StartElementHandler h_start_element; XML_EndElementHandler h_end_element; XML_CharacterDataHandler h_cdata; XML_ProcessingInstructionHandler h_pi; XML_CommentHandler h_comment; XML_DefaultHandler h_default; XML_UnparsedEntityDeclHandler h_unparsed_entity_decl; XML_NotationDeclHandler h_notation_decl; XML_ExternalEntityRefHandler h_external_entity_ref; XML_StartNamespaceDeclHandler h_start_ns; XML_EndNamespaceDeclHandler h_end_ns; } *XML_Parser; enum XML_Error { XML_ERROR_NONE, XML_ERROR_NO_MEMORY, XML_ERROR_SYNTAX, XML_ERROR_NO_ELEMENTS, XML_ERROR_INVALID_TOKEN, XML_ERROR_UNCLOSED_TOKEN, XML_ERROR_PARTIAL_CHAR, XML_ERROR_TAG_MISMATCH, XML_ERROR_DUPLICATE_ATTRIBUTE, XML_ERROR_JUNK_AFTER_DOC_ELEMENT, XML_ERROR_PARAM_ENTITY_REF, XML_ERROR_UNDEFINED_ENTITY, XML_ERROR_RECURSIVE_ENTITY_REF, XML_ERROR_ASYNC_ENTITY, XML_ERROR_BAD_CHAR_REF, XML_ERROR_BINARY_ENTITY_REF, XML_ERROR_ATTRIBUTE_EXTERNAL_ENTITY_REF, XML_ERROR_MISPLACED_XML_PI, XML_ERROR_UNKNOWN_ENCODING, XML_ERROR_INCORRECT_ENCODING, XML_ERROR_UNCLOSED_CDATA_SECTION, XML_ERROR_EXTERNAL_ENTITY_HANDLING, XML_ERROR_NOT_STANDALONE, XML_ERROR_UNEXPECTED_STATE, XML_ERROR_ENTITY_DECLARED_IN_PE, XML_ERROR_FEATURE_REQUIRES_XML_DTD, XML_ERROR_CANT_CHANGE_FEATURE_ONCE_PARSING }; enum XML_Content_Type { XML_CTYPE_EMPTY = 1, XML_CTYPE_ANY, XML_CTYPE_MIXED, XML_CTYPE_NAME, XML_CTYPE_CHOICE, XML_CTYPE_SEQ }; PHP_XML_API XML_Parser XML_ParserCreate(const XML_Char *); PHP_XML_API XML_Parser XML_ParserCreateNS(const XML_Char *, const XML_Char); PHP_XML_API XML_Parser XML_ParserCreate_MM(const XML_Char *, const XML_Memory_Handling_Suite *, const XML_Char *); PHP_XML_API void XML_SetUserData(XML_Parser, void *); PHP_XML_API void *XML_GetUserData(XML_Parser); PHP_XML_API void XML_SetElementHandler(XML_Parser, XML_StartElementHandler, XML_EndElementHandler); PHP_XML_API void XML_SetCharacterDataHandler(XML_Parser, XML_CharacterDataHandler); PHP_XML_API void XML_SetProcessingInstructionHandler(XML_Parser, XML_ProcessingInstructionHandler); PHP_XML_API void XML_SetDefaultHandler(XML_Parser, XML_DefaultHandler); PHP_XML_API void XML_SetUnparsedEntityDeclHandler(XML_Parser, XML_UnparsedEntityDeclHandler); PHP_XML_API void XML_SetNotationDeclHandler(XML_Parser, XML_NotationDeclHandler); PHP_XML_API void XML_SetExternalEntityRefHandler(XML_Parser, XML_ExternalEntityRefHandler); PHP_XML_API void XML_SetStartNamespaceDeclHandler(XML_Parser, XML_StartNamespaceDeclHandler); PHP_XML_API void XML_SetEndNamespaceDeclHandler(XML_Parser, XML_EndNamespaceDeclHandler); PHP_XML_API int XML_Parse(XML_Parser, const XML_Char *, int data_len, int is_final); PHP_XML_API int XML_GetErrorCode(XML_Parser); PHP_XML_API const XML_Char *XML_ErrorString(int); PHP_XML_API int XML_GetCurrentLineNumber(XML_Parser); PHP_XML_API int XML_GetCurrentColumnNumber(XML_Parser); PHP_XML_API int XML_GetCurrentByteIndex(XML_Parser); PHP_XML_API int XML_GetCurrentByteCount(XML_Parser); PHP_XML_API const XML_Char *XML_ExpatVersion(void); PHP_XML_API void XML_ParserFree(XML_Parser); #elif defined(HAVE_LIBEXPAT) #include "php.h" #include #endif /* HAVE_LIBEXPAT */ #endif /* PHP_EXPAT_COMPAT_H */ /* * Local variables: * tab-width: 4 * c-basic-offset: 4 * End: */ PK;N\ӄ0 xhtml10t.vimnu[PK;N\- Dhtml40s.vimnu[PK;N\@BHJ d~xhtml10f.vimnu[PK;N\BB Yhtml401s.vimnu[PK;N\^ xhtml11.vimnu[PK;N\1ubxsd.vimnu[PK;N\Pjj html401f.vimnu[PK;N\I(]GG6xsl.vimnu[PK;N\S html401t.vimnu[PK;N\>GG html32.vimnu[PK;N\U~]] html40t.vimnu[PK;N\1S\ xhtml10s.vimnu[PK;N\# Jhtml40f.vimnu[PKN\RRVetree/cElementTree.pynu[PKN\~h@eCeC3etree/__pycache__/ElementPath.cpython-311.opt-1.pycnu[PKN\xTK""6aetree/__pycache__/ElementInclude.cpython-311.opt-2.pycnu[PKN\xTK""6=tetree/__pycache__/ElementInclude.cpython-311.opt-1.pycnu[PKN\W0ņetree/__pycache__/__init__.cpython-311.opt-2.pycnu[PKN\}_}_3чetree/__pycache__/ElementTree.cpython-311.opt-1.pycnu[PKN\CfY4 etree/__pycache__/cElementTree.cpython-311.opt-1.pycnu[PKN\CfY4 etree/__pycache__/cElementTree.cpython-311.opt-2.pycnu[PKN\^Tkaa-9 etree/__pycache__/ElementTree.cpython-311.pycnu[PKN\H`##3bL etree/__pycache__/ElementTree.cpython-311.opt-2.pycnu[PKN\xTK""0c etree/__pycache__/ElementInclude.cpython-311.pycnu[PKN\~h@eCeC3jv etree/__pycache__/ElementPath.cpython-311.opt-2.pycnu[PKN\CfY.2 etree/__pycache__/cElementTree.cpython-311.pycnu[PKN\W*p etree/__pycache__/__init__.cpython-311.pycnu[PKN\W0v etree/__pycache__/__init__.cpython-311.opt-1.pycnu[PKN\~h@eCeC- etree/__pycache__/ElementPath.cpython-311.pycnu[PKN\q66D etree/ElementPath.pynu[PKN\ha""58 etree/ElementTree.pynu[PKN\[etree/ElementInclude.pynu[PKN\2QEEAvetree/__init__.pynu[PKN\}F|sax/_exceptions.pynu[PKN\//sax/saxutils.pynu[PKN\9==ؿsax/handler.pynu[PKN\&211sax/xmlreader.pynu[PKN\oQQ/.sax/__pycache__/xmlreader.cpython-311.opt-1.pycnu[PKN\hSYSY+!sax/__pycache__/expatreader.cpython-311.pycnu[PKN\00+sax/__pycache__/_exceptions.cpython-311.pycnu[PKN\x.sax/__pycache__/__init__.cpython-311.opt-2.pycnu[PKN\w<<'sax/__pycache__/handler.cpython-311.pycnu[PKN\w<<-.Csax/__pycache__/handler.cpython-311.opt-1.pycnu[PKN\hSYSY1\sax/__pycache__/expatreader.cpython-311.opt-1.pycnu[PKN\3c99/sax/__pycache__/xmlreader.cpython-311.opt-2.pycnu[PKN\祉 N N.Hsax/__pycache__/saxutils.cpython-311.opt-2.pycnu[PKN\001bsax/__pycache__/_exceptions.cpython-311.opt-1.pycnu[PKN\_1}sax/__pycache__/_exceptions.cpython-311.opt-2.pycnu[PKN\WW1sax/__pycache__/expatreader.cpython-311.opt-2.pycnu[PKN\S- sax/__pycache__/handler.cpython-311.opt-2.pycnu[PKN\jи]T]T./sax/__pycache__/saxutils.cpython-311.opt-1.pycnu[PKN\jи]T]T(Usax/__pycache__/saxutils.cpython-311.pycnu[PKN\j`(sax/__pycache__/__init__.cpython-311.pycnu[PKN\oQQ)Ծsax/__pycache__/xmlreader.cpython-311.pycnu[PKN\j`. sax/__pycache__/__init__.cpython-311.opt-1.pycnu[PKN\]1S?S?G%sax/expatreader.pynu[PKN\Z'::dsax/__init__.pynu[PKN\dUsdom/expatbuilder.pynu[PKN\oF, , Odom/minidom.pynu[PKN\g0 dom/__pycache__/minicompat.cpython-311.opt-1.pycnu[PKN\YFF0dom/__pycache__/xmlbuilder.cpython-311.opt-1.pycnu[PKN\d@v@v-_dom/__pycache__/minidom.cpython-311.opt-1.pycnu[PKN\-{.fdom/__pycache__/__init__.cpython-311.opt-2.pycnu[PKN\+SiEE-dom/__pycache__/pulldom.cpython-311.opt-2.pycnu[PKN\3W3305dom/__pycache__/NodeFilter.cpython-311.opt-2.pycnu[PKN\BΩΩ2:dom/__pycache__/expatbuilder.cpython-311.opt-2.pycnu[PKN\d^0"&dom/__pycache__/domreg.cpython-311.pycnu[PKN\X,dom/__pycache__/expatbuilder.cpython-311.pycnu[PKN\nxۑ*dom/__pycache__/NodeFilter.cpython-311.pycnu[PKN\ill-dom/__pycache__/minidom.cpython-311.opt-2.pycnu[PKN\\ODD0dom/__pycache__/xmlbuilder.cpython-311.opt-2.pycnu[PKN\2cdom/__pycache__/expatbuilder.cpython-311.opt-1.pycnu[PKN\ooRww'dom/__pycache__/minidom.cpython-311.pycnu[PKN\~GG-Wdom/__pycache__/pulldom.cpython-311.opt-1.pycnu[PKN\k ,Odom/__pycache__/domreg.cpython-311.opt-2.pycnu[PKN\~GG'dom/__pycache__/pulldom.cpython-311.pycnu[PKN\⍀NN**dom/__pycache__/minicompat.cpython-311.pycnu[PKN\s(N:dom/__pycache__/__init__.cpython-311.pycnu[PKN\nxۑ0Vdom/__pycache__/NodeFilter.cpython-311.opt-1.pycnu[PKN\d^0",[dom/__pycache__/domreg.cpython-311.opt-1.pycnu[PKN\s.ldom/__pycache__/__init__.cpython-311.opt-1.pycnu[PKN\rW FF*ۈdom/__pycache__/xmlbuilder.cpython-311.pycnu[PKN\^Nf 0dom/__pycache__/minicompat.cpython-311.opt-2.pycnu[PKN\Ec0c0Fdom/xmlbuilder.pynu[PKN\mmtdom/NodeFilter.pynu[PKN\' ' dom/minicompat.pynu[PKN\ȳ; dom/__init__.pynu[PKN\ 5Iu-u--0dom/pulldom.pynu[PKN\xw{ { ]dom/domreg.pynu[PKN\ő*k__pycache__/__init__.cpython-311.opt-2.pycnu[PKN\׼$l__pycache__/__init__.cpython-311.pycnu[PKN\׼*p__pycache__/__init__.cpython-311.opt-1.pycnu[PKN\1`*k)Rsparsers/__pycache__/expat.cpython-311.pycnu[PKN\0ڗ2auparsers/__pycache__/__init__.cpython-311.opt-2.pycnu[PKN\1`*k/qvparsers/__pycache__/expat.cpython-311.opt-1.pycnu[PKN\:xuu/xparsers/__pycache__/expat.cpython-311.opt-2.pycnu[PKN\V Tdd,Zzparsers/__pycache__/__init__.cpython-311.pycnu[PKN\V Tdd2|parsers/__pycache__/__init__.cpython-311.opt-1.pycnu[PKN\;|}parsers/__init__.pynu[PKN\;c}~parsers/expat.pynu[PKN\@ X-- __init__.pynu[PKN\Dui4((jfeed-icon-12x12-orange.pngnuPKN\܄feed-icon-16x16-orange.pngnuPKKO\tTX||"LicenseElement.phpnu[PKKO\aΉContainsElement.phpnu[PKKO\砲LElementCollection.phpnu[PKKO\zjExtensionElement.phpnu[PKKO\ExtElement.phpnu[PKKO\(7SSAuthorElementCollection.phpnu[PKKO\9S ManifestDocument.phpnu[PKKO\ܗKKЪRequiresElement.phpnu[PKKO\wO^PhpElement.phpnu[PKKO\$SgComponentElement.phpnu[PKKO\}zzBundlesElement.phpnu[PKKO\JJAExtElementCollection.phpnu[PKKO\2ӸAuthorElement.phpnu[PKKO\6 \\ComponentElementCollection.phpnu[PKKO\t)T  CopyrightElement.phpnu[PKKO\pnnManifestElement.phpnu[PKKO\ php_xml.hnu[PKKO\J9## xml_arginfo.hnu[PKKO\B(hnnexpat_compat.hnu[PKzz-